Align deoxyribose-phosphate aldolase (EC 4.1.2.4) (characterized)
to candidate WP_011423586.1 RHE_RS00980 deoxyribose-phosphate aldolase
Query= BRENDA::P0A6L0 (259 letters) >NCBI__GCF_000092045.1:WP_011423586.1 Length = 258 Score = 249 bits (636), Expect = 4e-71 Identities = 141/258 (54%), Positives = 181/258 (70%), Gaps = 7/258 (2%) Query: 4 LKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARKTLKEQ 63 ++ ++ AL L+DLT L DD T+ ++ LC +A+TP GN+AAICI+PRF+ AR L Sbjct: 6 IRETAAVALSLLDLTNLKDDCTEAQIDTLCVRAQTPYGNSAAICIWPRFVAYARNILGA- 64 Query: 64 GTPEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVK 123 G P +RIATV NFP G+ ++ AETR AIA GADE+D+V PYR L++GNE+ D+VK Sbjct: 65 GHP-VRIATVVNFPAGDMEVADVAAETREAIADGADEIDLVIPYRKLISGNEKAVTDMVK 123 Query: 124 ACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESAR 183 A + CA VLLKVIIETGELKD ALIR+ASE++I AGADFIKTSTGKVAVNAT E+A Sbjct: 124 AVRAECAGP-VLLKVIIETGELKDAALIRRASELAIGAGADFIKTSTGKVAVNATLEAAD 182 Query: 184 IMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLAS 243 IM+ IR+ G + VGFKPAGG+ + DA YL++A+ + DWA +RFGAS LL Sbjct: 183 IMIRAIRESG--RKVGFKPAGGIGSVADAALYLSLAETIMAPDWAMPSTFRFGASGLLDD 240 Query: 244 LLKALGHGD--GKSASSY 259 +L L +ASSY Sbjct: 241 ILAVLSGAQPAAAAASSY 258 Lambda K H 0.317 0.133 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 258 Length adjustment: 24 Effective length of query: 235 Effective length of database: 234 Effective search space: 54990 Effective search space used: 54990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate WP_011423586.1 RHE_RS00980 (deoxyribose-phosphate aldolase)
to HMM TIGR00126 (deoC: deoxyribose-phosphate aldolase (EC 4.1.2.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00126.hmm # target sequence database: /tmp/gapView.1559881.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00126 [M=211] Accession: TIGR00126 Description: deoC: deoxyribose-phosphate aldolase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-68 215.0 1.5 4.9e-68 214.7 1.5 1.0 1 NCBI__GCF_000092045.1:WP_011423586.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000092045.1:WP_011423586.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 214.7 1.5 4.9e-68 4.9e-68 3 207 .. 14 226 .. 12 229 .. 0.97 Alignments for each domain: == domain 1 score: 214.7 bits; conditional E-value: 4.9e-68 TIGR00126 3 akliDhtalkadtteedietlcaeAkky..kfaavcvnpsyvslAkelLk.gteveictvvgFPlGasttevk 72 ++l+D+t+lk+d te++i+tlc A+++ + aa+c+ p++v +A+++L g v+i+tvv+FP+G + NCBI__GCF_000092045.1:WP_011423586.1 14 LSLLDLTNLKDDCTEAQIDTLCVRAQTPygNSAAICIWPRFVAYARNILGaGHPVRIATVVNFPAGDMEVADV 86 689************************9999******************8799******************** PP TIGR00126 73 llEakeaieeGAdEvDvviniaalkdkneevviedikavveaca.kvllKvilEtalLtdeekk.kAseisie 143 ++E++eai+ GAdE+D+vi++++l ++ne++v++ +kav ca vllKvi+Et++L+d +++ +Ase++i NCBI__GCF_000092045.1:WP_011423586.1 87 AAETREAIADGADEIDLVIPYRKLISGNEKAVTDMVKAVRAECAgPVLLKVIIETGELKDAALIrRASELAIG 159 ****************************************9999789***************9889******* PP TIGR00126 144 agadfvKtstgfsakgAtvedvrlmkkvvgd...evgvKasGGvrtaedalalieagaerigasaav 207 agadf+Ktstg++a++At+e + +m +++++ +vg+K++GG+ + da +++ +++ +++++a+ NCBI__GCF_000092045.1:WP_011423586.1 160 AGADFIKTSTGKVAVNATLEAADIMIRAIREsgrKVGFKPAGGIGSVADAALYLSLAETIMAPDWAM 226 *****************************999999******************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (211 nodes) Target sequences: 1 (258 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 17.16 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory