Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate WP_011427844.1 RHE_RS23955 L-iditol 2-dehydrogenase
Query= reanno::BFirm:BPHYT_RS04775 (263 letters) >NCBI__GCF_000092045.1:WP_011427844.1 Length = 256 Score = 129 bits (325), Expect = 5e-35 Identities = 83/244 (34%), Positives = 121/244 (49%), Gaps = 2/244 (0%) Query: 16 LISGAAAGIGAAIAQAFLDVGANVYICDVD-PAAIDRARTAHPQLHAGVADVSDCAQVDR 74 LI+G A GIG A+AF+ GA V I D+D A A P A DV D + +D Sbjct: 9 LITGGARGIGLGFAEAFVKEGAKVVIADIDIERATKSAAAIGPVAKAMKLDVMDLSAIDT 68 Query: 75 IIDDARSKLGGLDLLINNAGIAGPTGAVEDLDPAEWERTIGTNLNSQFYFLRKAVPLLKE 134 + + + GG+D+L+NNA I V ++ A +++ NL + ++ ++ Sbjct: 69 FVAEVDKEFGGIDILVNNAAIFD-MAPVNEITEASYDKVFSINLKGPLFMMKAVSNVMIN 127 Query: 135 TSANPGIIAMASVAGRLGYAFRTPYAASKWAIVGMVKSLAIELGPNNVRVNAILPGVVEG 194 II MAS AGR G A Y ASK AI+ +S A+ L + VNAI PGVV+G Sbjct: 128 RGRGGKIINMASQAGRRGEALVLLYCASKAAIISATQSAALALVKYGINVNAIAPGVVDG 187 Query: 195 ERMDRVISARAESLGIGFDQMKGEYLQKISLRRMVTVHDVAAMALFLASPAGQNISGQAI 254 E D V + A+ G+ + K + + + R T D+ +A+FLAS I Q Sbjct: 188 EHWDIVDAHFAKWEGLKPGEKKAAVAKSVPIGRFATPDDIKGLAVFLASSDSDYILAQTY 247 Query: 255 SVDG 258 +VDG Sbjct: 248 NVDG 251 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 256 Length adjustment: 24 Effective length of query: 239 Effective length of database: 232 Effective search space: 55448 Effective search space used: 55448 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory