Align GluD aka CGL1953, component of Glutamate porter (characterized)
to candidate WP_011427808.1 RHE_RS23760 amino acid ABC transporter permease
Query= TCDB::P48245 (273 letters) >NCBI__GCF_000092045.1:WP_011427808.1 Length = 251 Score = 102 bits (254), Expect = 8e-27 Identities = 65/211 (30%), Positives = 116/211 (54%), Gaps = 9/211 (4%) Query: 27 LPGLWGTLKSAVFSVILALVMGTALGLGRISEIRILRWFCAVIIETFRAIPVLILMIFAY 86 L GL TL + S+ LA + + R+S+ +LRW ++ R +P+L+L++++Y Sbjct: 26 LGGLANTLILSALSIALAFPISILFAMARLSKAPLLRWPVTALVYFTRGVPLLMLILWSY 85 Query: 87 QMFAQYNIVPSSQLAFAAVVFGLTMYNGSVIAEILRSGIASLPKGQKEAAIALGMSSRQT 146 F + + +F ++ L +Y + ++E++R+GI +L GQ +A+ ALG S Sbjct: 86 --FLVPLLTGADVPSFVTMLTTLVVYQSAFLSEVVRAGIVALGPGQMDASRALGHSYVGA 143 Query: 147 TWSILLPQAVAAMLPALISQMVIALKDSALGYQIGYIEVVRSGIQSASVNRNYLAALFVV 206 I+LPQA+ M+P+++S V +KD+ LGY I ++ ++ VN L F V Sbjct: 144 MRYIILPQALYNMIPSILSTFVSTIKDTTLGYVINVPDLT---FAASQVNNQLLTQPFQV 200 Query: 207 ALIMIVLNF----SLTALASRIERQLRAGRA 233 LI+ ++ F +LT A+R+ER++ RA Sbjct: 201 FLILAIVYFAICWTLTYFANRLERRITRRRA 231 Lambda K H 0.323 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 177 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 251 Length adjustment: 25 Effective length of query: 248 Effective length of database: 226 Effective search space: 56048 Effective search space used: 56048 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory