Align BraC, component of General L- (and D-)amino acid uptake porter (transports acidic, basic, polar, semipolar and hydrophobic amino acids). The amino and carboxyl groups do not need to be α since γ-aminobutyric acid (GABA) is a substrate. The system may function with additional binding proteins since L-alanine uptake is not dependent on BraC (characterized)
to candidate WP_011426329.1 RHE_RS15820 branched-chain amino acid ABC transporter substrate-binding protein
Query= TCDB::Q9L3M3 (381 letters) >NCBI__GCF_000092045.1:WP_011426329.1 Length = 367 Score = 320 bits (821), Expect = 3e-92 Identities = 165/350 (47%), Positives = 221/350 (63%), Gaps = 1/350 (0%) Query: 11 LTAMLAFSGNAWADVLIAVAGPLTGPNAAFGAQLQKGAEQAAADINAAGGINGEQIKIEL 70 L A LAF+ A AD+ I + PLTGP AA+G Q++ GA+ A +IN GGI GE++ +EL Sbjct: 10 LVASLAFAPLAHADIAIGLIAPLTGPVAAYGDQVKNGAQTAVDEINKKGGILGEKVVLEL 69 Query: 71 GDDVSDPKQGISVANKFAADGVKFVIGHFNSGVSIPASEVYAENGILRNHPGRDEPDLHG 130 DD +PKQG+S ANK DG++FV+G SGV+IP S+V AENG+L P PDL Sbjct: 70 ADDAGEPKQGVSAANKVVGDGIRFVVGPVTSGVAIPVSDVLAENGVLMVTPTATAPDLTK 129 Query: 131 TGLWNTFRTCGRDDQQGAIAGKYLADHFKDAKIAVVHDKTPYGQGLADETKKAMNAAGVT 190 GL N RTCGRDDQQ +A KY+ +FKD +IA+V+DK YG+GLAD K +NA G+T Sbjct: 130 RGLANVLRTCGRDDQQAEVAAKYVLKNFKDKRIAIVNDKGAYGKGLADAFKATLNAGGIT 189 Query: 191 EVIYEGINVGDKDFSALIAKMKEAGVSIIYWGGLHTEAGLIIRQAADQGLKATLVSGDGI 250 EV+ + I GDKDFSAL ++K V I+Y+GG H E GL+ RQ D A ++ GDG+ Sbjct: 190 EVVNDAITPGDKDFSALTTRIKSEKVDIVYFGGYHPEGGLLARQLHDLSANAMIIGGDGL 249 Query: 251 VSNELASIAGDAVAGTLNTFGPDPTANPANKELVEKFKAAGFNPEAYTLYSYAAMQTI-A 309 + E +I DA AGTL T D T NP +K E A EA+TL +YAA++ + A Sbjct: 250 SNTEFWAIGTDAAAGTLFTNASDATKNPDSKAAAEALTAKNIPAEAFTLNAYAAVEVLKA 309 Query: 310 GAAKAAGSLDPEAVAKAMKEKGPFPTVLGDISFDEKGDPKIPGYIMYEWK 359 G KA + D EAVA A+K PT +G +++ E GD + +Y+W+ Sbjct: 310 GIEKAGSAEDAEAVAAALKGGMEVPTAIGKLTYGETGDLTSQSFSLYKWE 359 Lambda K H 0.314 0.132 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 421 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 367 Length adjustment: 30 Effective length of query: 351 Effective length of database: 337 Effective search space: 118287 Effective search space used: 118287 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory