Align Branched-chain amino acid aminotransferase (EC 2.6.1.42) (characterized)
to candidate WP_011425978.1 RHE_RS13980 branched-chain amino acid aminotransferase
Query= reanno::Cup4G11:RR42_RS25890 (363 letters) >NCBI__GCF_000092045.1:WP_011425978.1 Length = 366 Score = 459 bits (1180), Expect = e-134 Identities = 220/349 (63%), Positives = 259/349 (74%) Query: 9 LEPNPNALDAATRDALMRDPAFGRVFTDHMVTITWREGQGWQDAKVTARKPFSIDPACSV 68 +E + + + A R + P FG++FTDHMV W +GW DAKVT R+P +DPA +V Sbjct: 12 IELHKSPVSDAERLQALEAPGFGKLFTDHMVLARWTADKGWHDAKVTPRRPLELDPASAV 71 Query: 69 LHYGQEIFEGMKAYRGADGAVTLFRPLENARRFQASAKRMAMPALPESLFLEAIEQLVRI 128 LHY QEIFEGMKAY+ DG + LFRP ENARRF SA RMAMP +PE LFL+A+E LVR+ Sbjct: 72 LHYAQEIFEGMKAYKADDGRILLFRPEENARRFAQSATRMAMPPVPEELFLKAVEALVRV 131 Query: 129 DQAWVPHGSGSLYLRPFMFANEVFLGIKPASEFIFCVIACPVGPYFKGGDKAVSVWVSEN 188 D+ W+P G SLYLRPFMFANE FLG++PA E++FCVIA PVG YFKGG KAVS+WV Sbjct: 132 DKGWIPSGDASLYLRPFMFANEAFLGVRPAQEYVFCVIASPVGAYFKGGAKAVSLWVETE 191 Query: 189 YTRAAPGGTGEAKCGGNYAGSLVAQNEATANGCDQVVFLDAAEHRWVEELGGMNIFFVMD 248 YTRAA GGTG AKCGGNYA SLVAQ EA+ GCDQVVFLDAAEHRWVEELGGMN+FFVM+ Sbjct: 192 YTRAASGGTGAAKCGGNYAASLVAQAEASKRGCDQVVFLDAAEHRWVEELGGMNVFFVMN 251 Query: 249 DGTLVTPPLSGSILPGITRASVIELAREMGMVVEERRYSYPEWEADAKSGRLAEAFVCGT 308 DG++VTPPL G+ILPGITRASVI LA E G VE+R YS+ EW+ DA SG+L EAF CGT Sbjct: 252 DGSMVTPPLGGTILPGITRASVIVLAEERGFRVEQRPYSFAEWQEDAASGKLVEAFACGT 311 Query: 309 AATLVAIGEVRSARTRFAIGNGTAGNTVKVLRDRLVEIQRNQAAGPAGW 357 AA L IG VR A F +G+G G LR +LV +Q+ GW Sbjct: 312 AAVLAGIGLVRHAGGEFLVGDGQTGKLTSELRQQLVSLQKGVTNDVHGW 360 Lambda K H 0.321 0.135 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 457 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 366 Length adjustment: 29 Effective length of query: 334 Effective length of database: 337 Effective search space: 112558 Effective search space used: 112558 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
Align candidate WP_011425978.1 RHE_RS13980 (branched-chain amino acid aminotransferase)
to HMM TIGR01123 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01123.hmm # target sequence database: /tmp/gapView.3723303.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01123 [M=313] Accession: TIGR01123 Description: ilvE_II: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-128 412.9 0.0 4.2e-128 412.7 0.0 1.0 1 NCBI__GCF_000092045.1:WP_011425978.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000092045.1:WP_011425978.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 412.7 0.0 4.2e-128 4.2e-128 1 310 [. 52 361 .. 52 364 .. 0.99 Alignments for each domain: == domain 1 score: 412.7 bits; conditional E-value: 4.2e-128 TIGR01123 1 WdeaelaseaeleldegsavlhYgqevfeGlkayRtadGkillfRpdanakRlrrsaerlllPeleeelflea 73 W++a++++ +leld++savlhY+qe+feG+kay+ +dG+illfRp++na+R+ +sa r+++P ++eelfl+a NCBI__GCF_000092045.1:WP_011425978.1 52 WHDAKVTPRRPLELDPASAVLHYAQEIFEGMKAYKADDGRILLFRPEENARRFAQSATRMAMPPVPEELFLKA 124 ************************************************************************* PP TIGR01123 74 lkqlvkadkdwvpkakseasLYlRPfliatednlGvkaakeylflvlasPvGaYfkgglapvsifveteyvRa 146 ++ lv++dk w+p+ ++asLYlRPf++a e+ lGv++a+ey+f+v+asPvGaYfkgg + vs +vetey+Ra NCBI__GCF_000092045.1:WP_011425978.1 125 VEALVRVDKGWIPS--GDASLYLRPFMFANEAFLGVRPAQEYVFCVIASPVGAYFKGGAKAVSLWVETEYTRA 195 *************4..56******************************************************* PP TIGR01123 147 apkGtGavkvgGnYaasllaqkkaaeqglddvvyldpvekkkieevGaaniflitkdgelvttplsesiLegv 219 a +GtGa+k+gGnYaasl aq++a+++g+d+vv+ld++e++ +ee+G++n+f++++dg++vt+pl + iL+g+ NCBI__GCF_000092045.1:WP_011425978.1 196 ASGGTGAAKCGGNYAASLVAQAEASKRGCDQVVFLDAAEHRWVEELGGMNVFFVMNDGSMVTPPLGGTILPGI 268 ************************************************************************* PP TIGR01123 220 tresllelakdlgleveereiaidelkaaveaGei..vfacGtaavitPvgelkiegkevevkseevGevtkk 290 tr+s++ la+++g++ve r + e+++ +++G++ +facGtaav++ +g +++ g e+ v ++++G++t + NCBI__GCF_000092045.1:WP_011425978.1 269 TRASVIVLAEERGFRVEQRPYSFAEWQEDAASGKLveAFACGTAAVLAGIGLVRHAGGEFLVGDGQTGKLTSE 341 *********************************99889*********************************** PP TIGR01123 291 lrdeltdiqyGkledkegWi 310 lr++l+++q G ++d +gW+ NCBI__GCF_000092045.1:WP_011425978.1 342 LRQQLVSLQKGVTNDVHGWT 361 *******************7 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (313 nodes) Target sequences: 1 (366 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 20.21 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory