Align methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate WP_011423740.1 RHE_RS01800 enoyl-CoA hydratase
Query= BRENDA::F4JML5 (301 letters) >NCBI__GCF_000092045.1:WP_011423740.1 Length = 257 Score = 169 bits (429), Expect = 5e-47 Identities = 93/241 (38%), Positives = 139/241 (57%), Gaps = 3/241 (1%) Query: 58 VNLDRPVTKNAINKEMLKSLQNAFESIHQDNSARVVMIRSLVPGVFCAGADLKERRTMSP 117 V L+RP NA+N +LK L+ A+ + H D + ++I F AGAD+KE +++ Sbjct: 17 VTLNRPQALNALNSTVLKELKAAYAAFHADEAIGAIVITGS-ERAFAAGADIKEMQSLQF 75 Query: 118 SEVHTYVNSLRYMFSFIEALSIPTIAAIEGAALGGGLEMALACDLRICGENAVFGLPETG 177 +++ Y + + I P IAA+ G ALGGG E+A+ CD I E A FG PE Sbjct: 76 ADI--YKSDFISGWDDIAKARKPVIAAVSGFALGGGCELAMMCDFIIASETAKFGQPEIT 133 Query: 178 LAIIPGAGGTQRLSRLVGRSVSKELIFTGRKIDAIEAANKGLVNICVTAGEAHEKAIEMA 237 L +IPG GG+QRL+R VG++ + +L+ TGR +DA EA GLV+ V ++A+ A Sbjct: 134 LGVIPGMGGSQRLTRAVGKAKAMDLVLTGRMMDAAEAERSGLVSRVVAPERLLDEALAAA 193 Query: 238 QQINEKGPLAIKMAKKAIDEGIETNMASGLEVEEMCYQKLLNTQDRLEGLAAFAEKRKPL 297 ++I ++ MAK+A++ ET + GL E + L T D+ EG+AAF EKRKP Sbjct: 194 EKIASLSQPSVMMAKEAVNRAFETTLEEGLRFERRLFHSLFATDDQKEGMAAFVEKRKPA 253 Query: 298 Y 298 + Sbjct: 254 F 254 Lambda K H 0.318 0.134 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 257 Length adjustment: 25 Effective length of query: 276 Effective length of database: 232 Effective search space: 64032 Effective search space used: 64032 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory