Align MtlG, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized)
to candidate WP_011427728.1 RHE_RS23355 carbohydrate ABC transporter permease
Query= TCDB::O30493 (276 letters) >NCBI__GCF_000092045.1:WP_011427728.1 Length = 303 Score = 178 bits (451), Expect = 1e-49 Identities = 97/272 (35%), Positives = 153/272 (56%), Gaps = 17/272 (6%) Query: 22 AILIFFPIFWMVLTSFKTEIDAFATP--PQFIFTPTLENYLHIN-----------ERSNY 68 A + FP+FW V TSFKT D P F F P+ + + R + Sbjct: 32 ACVCIFPLFWTVSTSFKTAADVMRGNLIPWFNFAPSWLGWRSLGLSPDTIPQISTVRDEF 91 Query: 69 FSYAWNSVLISFSATALCLLISVPAAYSMAFYETK----RTKSTLLWMLSTKMLPPVGVL 124 WNSV+IS +A+AL +++ AAY ++ + K R + LS ++PPV + Sbjct: 92 MRRLWNSVIISVTASALAVVLGSLAAYGLSRFSYKFGHMRNSDISFFFLSQLIMPPVVLA 151 Query: 125 MPIYLLAKSFGLLDTRIALIIIYTLINLPIVVWMVYTYFKDIPKDILEAARLDGATLWQE 184 +P +L K LLDT +I +YTL+ LPIVVW++ F IP ++ EAA +DG ++W Sbjct: 152 LPFLVLYKELALLDTYAGMIAVYTLMVLPIVVWIMRDQFATIPVELEEAALVDGLSVWGA 211 Query: 185 MVRVLLPIAKGGLASTVLLSLILCWNEAFWSLNLTSSNAAPLTALIASYSSPEGLFWAKL 244 R+++P+ G+ + LL+LILCWNE F++ LTS+N L +IAS + +G+ W + Sbjct: 212 FARIIVPLVLPGMVAAFLLALILCWNEYFFAALLTSTNTNTLPVMIASQTGSQGINWWSM 271 Query: 245 SAVSTLACAPILIFGWISQKQLVRGLSFGAVK 276 +A+ST P++I G + +K ++ G++ GAVK Sbjct: 272 AALSTAGILPLVIVGVVLEKHIIAGMTAGAVK 303 Lambda K H 0.327 0.137 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 302 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 303 Length adjustment: 26 Effective length of query: 250 Effective length of database: 277 Effective search space: 69250 Effective search space used: 69250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory