Align Leu/Ile/Val-binding protein LivJ aka B3460 aka LIV-BP, component of Leucine; leucine/isoleucine/valine porter (characterized)
to candidate WP_011426329.1 RHE_RS15820 branched-chain amino acid ABC transporter substrate-binding protein
Query= TCDB::P0AD96 (367 letters) >NCBI__GCF_000092045.1:WP_011426329.1 Length = 367 Score = 275 bits (702), Expect = 2e-78 Identities = 154/357 (43%), Positives = 213/357 (59%), Gaps = 7/357 (1%) Query: 6 KALLAGCIA-LAFSNMALAEDIKVAVVGAMSGPVAQYGDQEFTGAEQAVADINAKGGIKG 64 K L A +A LAF+ +A A DI + ++ ++GPVA YGDQ GA+ AV +IN KGGI G Sbjct: 4 KTLTATLVASLAFAPLAHA-DIAIGLIAPLTGPVAAYGDQVKNGAQTAVDEINKKGGILG 62 Query: 65 NKLQIVKYDDACDPKQAVAVANKVVNDGIKYVIGHLCSSSTQPASDIYEDEGILMITPAA 124 K+ + DDA +PKQ V+ ANKVV DGI++V+G + S P SD+ + G+LM+TP A Sbjct: 63 EKVVLELADDAGEPKQGVSAANKVVGDGIRFVVGPVTSGVAIPVSDVLAENGVLMVTPTA 122 Query: 125 TAPELTARGYQLILRTTGLDSDQGPTAAKYILEKVKPQRIAIVHDKQQYGEGLARAVQDG 184 TAP+LT RG +LRT G D Q AAKY+L+ K +RIAIV+DK YG+GLA A + Sbjct: 123 TAPDLTKRGLANVLRTCGRDDQQAEVAAKYVLKNFKDKRIAIVNDKGAYGKGLADAFKAT 182 Query: 185 LKKGNANVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQ 244 L G V D IT G+KDFS L R+K E +D VY+GGYHPE G + RQ Sbjct: 183 LNAGGITEVVNDAITPGDKDFSALTTRIKSEKVDIVYFGGYHPEGGLLARQLHDLSANAM 242 Query: 245 FMGPEGVANVSLSNIAGESAEGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFVWTTY 304 +G +G++N I ++A G L T + + P +K +A+ A K P+ AF Y Sbjct: 243 IIGGDGLSNTEFWAIGTDAAAGTLFTNASDATKNPDSKAAAEALTA-KNIPAEAFTLNAY 301 Query: 305 AALQSLQAGLNQ---SDDPAEIAKYLKAN-SVDTVMGPLTWDEKGDLKGFEFGVFDW 357 AA++ L+AG+ + ++D +A LK V T +G LT+ E GDL F ++ W Sbjct: 302 AAVEVLKAGIEKAGSAEDAEAVAAALKGGMEVPTAIGKLTYGETGDLTSQSFSLYKW 358 Lambda K H 0.314 0.133 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 359 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 367 Length adjustment: 30 Effective length of query: 337 Effective length of database: 337 Effective search space: 113569 Effective search space used: 113569 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory