Align Maltose transport system permease protein malG aka TT_C1629, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized)
to candidate WP_011428403.1 RHE_RS26905 carbohydrate ABC transporter permease
Query= TCDB::Q72H66 (280 letters) >NCBI__GCF_000092045.1:WP_011428403.1 Length = 299 Score = 184 bits (466), Expect = 3e-51 Identities = 103/275 (37%), Positives = 161/275 (58%), Gaps = 12/275 (4%) Query: 11 LFFYLLVVFVVVYSVFPFYWAVISSFKPSDAL-----FSPDPSFLPVPFTLEHYENVFLQ 65 + YL + V +FPFYW I++ KP++ L +SP F V TL+H + +FL+ Sbjct: 30 VMLYLPMAVFVFVLLFPFYWMAITAVKPNEQLTDYNNYSP---FWVVGPTLDHIKYLFLE 86 Query: 66 ANFGRNLLNSLIVAGGATLLSLVLGVLAAYALGRLPFPPKNAVMYIVLSMTMFPQIAVLG 125 ++ L N+++VA G+T LSLV V AYA+ R+ F + ++ + P + Sbjct: 87 TSYPGWLWNTMLVAAGSTALSLVASVFGAYAIERVRFTGARQIGLVIFLAYLIPPSILFI 146 Query: 126 GLFLLLRQTGLFNTHLGLILTYLLFTLPFTVWVLVGYFRGLPRELEEAAYVDGATPLQTL 185 L ++ + G++++ L LI TY F +PF W+L+GYFR +P ELEE+A VDGA Q L Sbjct: 147 PLAFIVFKLGIYDSRLALIFTYPTFLIPFCTWLLMGYFRSIPFELEESALVDGANRWQIL 206 Query: 186 LKVMLPLTGPGLVTTGLLAFIAAWNEYLFALTFTVGDSVKTVPPAI-ASFGGATPFEIPW 244 +K++LPL PGL++ G+ AF +WNE+++ALTF KT+P + FE W Sbjct: 207 VKIILPLAVPGLISAGIFAFTLSWNEFIYALTFIQSSENKTIPVGVLTELVRGDVFE--W 264 Query: 245 GSIMAASVVVTVPLVVLVLVFQQRIVAGLTAGAVK 279 GS+MA ++ ++P+V+L F V+ +T GAVK Sbjct: 265 GSLMAGALFGSLPVVILYSFFVDYYVSSMT-GAVK 298 Lambda K H 0.329 0.145 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 280 Length of database: 299 Length adjustment: 26 Effective length of query: 254 Effective length of database: 273 Effective search space: 69342 Effective search space used: 69342 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory