Align benzoyl-CoA reductase (EC 1.3.7.8) (characterized)
to candidate WP_013134793.1 ARNIT_RS04930 acyl-CoA dehydratase activase
Query= BRENDA::Q8VUG0 (301 letters) >NCBI__GCF_000092245.1:WP_013134793.1 Length = 253 Score = 122 bits (307), Expect = 7e-33 Identities = 87/261 (33%), Positives = 138/261 (52%), Gaps = 16/261 (6%) Query: 41 GIDVGSVSSQAVLVCDG-ELYGYNSMRTGNNSPDSAKNALQGIMDKIGMKLEDINYVVGT 99 G+DVGS ++ + + EL + + T N + K L K +DI +V T Sbjct: 4 GVDVGSTYTKICGINEKKELVDMSVIPTIVNQDEIVKKYL---------KDKDIKMLVST 54 Query: 100 GYGR--VNVPFAHKAITEIACHARGANYMGGNKVRTILDMGGQDCKAIHCDDKGKVTNFL 157 GYGR + F+ I+EI HA+GA Y N + ++D+GGQD K I D G +F Sbjct: 55 GYGRHMIEETFSCLVISEIKAHAKGA-YFFNNDAQMVIDLGGQDSKVILLDKSGGFVDFK 113 Query: 158 MNDKCAAGTGRGMEVISDLMQIPIAELGPRSFDVETEPEAVSSICVVFAKSEALGLLKAG 217 MNDKCAAGTG+ +E+ ++ M + + E FD + ++SS+C VFA+SE + L+ Sbjct: 114 MNDKCAAGTGKFLEIAANRMGLNLDEFSKIGFDA-NKKLSISSMCAVFAESEVVSLIAKR 172 Query: 218 YTKNMVIAAYCQAMAERVVSLLERIGVE-EGFFITGGIAKNPGVVKRIERLLGIKQLETK 276 + + + A +++A R+ S+ + + E TGG A + +V + L L +K Sbjct: 173 ESASNICYAVHESIASRLASMANKFACKSEVILFTGGGALDSFLVSLLSEKLEKTILPSK 232 Query: 277 IDSQIAGALGAALFGYTLMQK 297 Q+ GA+GAAL GY + Q+ Sbjct: 233 Y-PQLTGAIGAALCGYEIYQE 252 Lambda K H 0.318 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 253 Length adjustment: 25 Effective length of query: 276 Effective length of database: 228 Effective search space: 62928 Effective search space used: 62928 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory