Align 4-hydroxy-2-oxohexanoate aldolase (EC 4.1.3.43) (characterized)
to candidate WP_013134754.1 ARNIT_RS04745 aldolase catalytic domain-containing protein
Query= BRENDA::Q53WI0 (347 letters) >NCBI__GCF_000092245.1:WP_013134754.1 Length = 322 Score = 102 bits (255), Expect = 1e-26 Identities = 84/275 (30%), Positives = 126/275 (45%), Gaps = 14/275 (5%) Query: 5 LSTAKPPVVVDTTLRDGSHAHRHQYTVEEARAIAQALDEAGVYAIEVSHGDGLG-GSSLQ 63 LS + V D T+RDG + + +T E +A + AGV +E+ + S + Sbjct: 9 LSVREDIKVFDCTIRDGGLVNNYHFTDEFVKAHYETCVAAGVDYMEIGKNNSPSIMSEDE 68 Query: 64 YG-FSRTDEMELIRAVRETVRRAKVAALLLPGIGTRKELKEAVEAGIQMVRIATQCTEAD 122 YG ++ E ++ R V E K+A + G EL E+ + M+RIAT + Sbjct: 69 YGAWNFCKEEDIRRIVGENNTGMKIAVMSDIGRTVPSELLPKSESVVDMIRIATYIHQLP 128 Query: 123 ISEQHFGMAKEMGLEAVGFLMMSHMRPPEFLAEQARLMEGYGADVVYIVDSAGAMLPEDA 182 + + A G E +M + L E + D++YI DS G+ PE Sbjct: 129 AAIELIEEAHAKGYETTVNIMAISKSFDDELNEVLEQLSKTNVDIIYIADSFGSFYPEQI 188 Query: 183 YARVKALKEALSRA-----KVGFHAHNNLGLAIGNTLAALAAGADWVDATLRGYGAGAGN 237 K ++ LS A K+G HAHNNL LA NT+ A+ GA ++D T+ G G GAGN Sbjct: 189 N---KLTEKYLSYAEKTGKKIGIHAHNNLQLAYANTIEAMMYGASFLDVTISGLGRGAGN 245 Query: 238 APLEVLAAVLDKAGLNPGLDVFKLLDAAEYVMGPI 272 PLE+L L NP + +L E + P+ Sbjct: 246 CPLELLIGFLK----NPKYKLMPVLKFIEEYIVPL 276 Lambda K H 0.319 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 322 Length adjustment: 28 Effective length of query: 319 Effective length of database: 294 Effective search space: 93786 Effective search space used: 93786 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory