Align 3-oxopimeloyl-CoA:CoA acetyltransferase (characterized)
to candidate WP_013135151.1 ARNIT_RS06730 thiolase family protein
Query= metacyc::MONOMER-20679 (395 letters) >NCBI__GCF_000092245.1:WP_013135151.1 Length = 423 Score = 221 bits (564), Expect = 2e-62 Identities = 148/433 (34%), Positives = 218/433 (50%), Gaps = 61/433 (14%) Query: 6 IVSTARTPIGKAYRGALNATEGATLLGHAIEHAVKRAGIDPKEVEDVVMGAAMQQGATGG 65 I+ R+P+ KA G LN +L + V R I + ++V++G Q A Sbjct: 7 IIDGLRSPVAKA-NGKLNNVSADSLGAIIAKELVLRNNIPYDDFDEVIIGNVAQP-ANAA 64 Query: 66 NIARKALLRAGLPVTTAGTTIDRQCASGLQAIALAARSVLFDGVEIAVGGGGESISLVQ- 124 NIAR +RAG P T T+ R CASG+QA++ + + +I + GG ES+S + Sbjct: 65 NIARVLAMRAGFPKKTIAYTVHRNCASGMQALSSSIEKIYTKQGKIYLAGGVESMSNIPL 124 Query: 125 ------NDKMNTFHAVDPALEAIK--GDVYMAMLD--------------------TAETV 156 D M F E +K ++ L TAE + Sbjct: 125 LFSNQFKDFMTKFTYAKSTSEKLKLLTSFRLSFLKPTIGLISGLTDPISGKIMGITAENL 184 Query: 157 AKRYGISRERQDEYSLESQRRTAAAQQGGKFNDEIAPISTKMGVVDKATGAVSFKDITLS 216 A + ISR+ QDEYSL+S + A + G NDEI PI T KD ++ Sbjct: 185 ANEFKISRQAQDEYSLQSHLKAQKAIESGILNDEIHPIMT--------------KDSSIM 230 Query: 217 QDEGPRPETTAEGLAGLKAVRGEGFTITAGNASQLSDGASATVIMSDKTAAAKGLKPLGI 276 D+G R T + L LK + T+TAGN+SQ+SDGA ++ S+ A GL+P+G Sbjct: 231 DDDGIRFNQTIQALNKLKPIFDRNGTVTAGNSSQVSDGACMMILCSESKAKELGLEPIGF 290 Query: 277 FRGMVSYGCEPDEMGIGPVFAVPRLLKRHGLSVDDIGLWELNEAFAVQVL---------- 326 + G + ++MG+GP+FA +L + G+S+ +I L ELNEAFA QV+ Sbjct: 291 IKDYAYAGLDANKMGLGPIFATKKLFDKTGVSLKNIDLIELNEAFAAQVIANLEAFKSKS 350 Query: 327 YCRDKLGIDP------EKLNVNGGAISVGHPYGMSGARLAGHALIEGRRRKAKYAVVTMC 380 +C+ + +P E LNVNGGAI++GHP GMSGAR+ H + E +R+ K + T+C Sbjct: 351 FCKKEFNSEPLGEINEEILNVNGGAIAIGHPVGMSGARIVLHTVKELKRKGLKTGLATLC 410 Query: 381 VGGGMGSAGLFEI 393 VGGG G++ L E+ Sbjct: 411 VGGGQGASFLVEV 423 Lambda K H 0.316 0.134 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 391 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 423 Length adjustment: 31 Effective length of query: 364 Effective length of database: 392 Effective search space: 142688 Effective search space used: 142688 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory