Align succinate-semialdehyde dehydrogenase (EC 1.2.1.16) (characterized)
to candidate WP_013133826.1 ARNIT_RS00055 aldehyde dehydrogenase
Query= reanno::pseudo3_N2E3:AO353_11505 (480 letters) >NCBI__GCF_000092245.1:WP_013133826.1 Length = 483 Score = 349 bits (895), Expect = e-100 Identities = 187/470 (39%), Positives = 284/470 (60%), Gaps = 4/470 (0%) Query: 12 QAFIDGAWVDADNGQTINVTNPATGEILGTVPKMGAAETRRAIEAADKALPAWRALTAKE 71 + +I+G +V ++ G+T V NP+T EI+ +PK A + + AI+AA A AW L A E Sbjct: 8 EMYINGEFV-SNKGETTPVINPSTKEIISYIPKGNAEDAKVAIDAAHNAQDAWAKLPAVE 66 Query: 72 RANKLRRWFELIIENQDDLARLMTLEQGKPLAEAKGEIVYAASFIEWFAEEAKRIYGDVI 131 R N LR+ + I EN D LA+ +T EQGK L A+ E+ + A ++++ AE A+R G++I Sbjct: 67 RGNYLRKIAQKIRENSDMLAKTITQEQGKVLGLAEVEVNFTADYLDYMAEWARRYEGEII 126 Query: 132 PGHQPDKRLIVIKQPIGVTAAITPWNFPAAMITRKAGPALAAGCTMVLKPASQTPYSAFA 191 +P++ + + K PIGV + PWNFP +I RK PAL G T+V+KP+ +TP +AF Sbjct: 127 QSDRPNENIFLFKLPIGVATGVLPWNFPFFLIARKLAPALLTGNTIVIKPSGETPNNAFE 186 Query: 192 LAELAQRAGIPKGVLSVVTGSAGDIGSELTSNPIVRKLSFTGSTEIGRQLMAECAKDIKK 251 A+L + +PKGV ++V+GS +G+EL +N V +SFTGS G ++M +K++ K Sbjct: 187 FAKLVDQIDLPKGVFNLVSGSGSTVGNELAANEKVGIVSFTGSVPTGVKIMEAASKNVTK 246 Query: 252 VSLELGGNAPFIVFDDADLDKAVEGAIISKYRNNGQTCVCANRLYIQDSVYDAFAEKLKV 311 VSLELGG AP IV DA+LD AVE S+ NNGQ C CA R+Y+ S+ F +++ Sbjct: 247 VSLELGGKAPAIVMADANLDIAVEAIKNSRVTNNGQVCNCAERVYVHKSIAKEFTDRITK 306 Query: 312 AVAKLKIGNGLEEGTTTGPLIDGKAVAKVQEHIADALSKGATLLAGGKVM---EGNFFEP 368 ++A L GN L E GPLI+ A+ VQ+ + A++ GA++ GGK +G F+EP Sbjct: 307 SMAALTCGNPLTEKIDMGPLINEDAITHVQKLVDSAVAAGASITTGGKRCDRDDGYFYEP 366 Query: 369 TILTNVPKSAAVAKEETFGPLAPLFRFKDEAEVIAMSNDTEFGLASYFYARDLGRVFRVA 428 T++ +V + + KEE FGP+ P+ F E IA++ND+EFGL S Y ++L R Sbjct: 367 TVVIDVKQDMDIIKEEIFGPVLPIVTFDTLDEAIALANDSEFGLTSSIYTQNLDIAMRAC 426 Query: 429 EALEYGMVGVNTGLISNEVAPFGGIKASGLGREGSKYGIEDYLEIKYLCL 478 + ++ G +N G K SG+G K+G+E++L+ K + L Sbjct: 427 KEIKCGETYINRENFEAMQGFHAGWKKSGIGGADGKHGLEEFLQTKVVYL 476 Lambda K H 0.317 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 545 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 480 Length of database: 483 Length adjustment: 34 Effective length of query: 446 Effective length of database: 449 Effective search space: 200254 Effective search space used: 200254 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory