Align L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) (characterized)
to candidate WP_013133826.1 ARNIT_RS00055 aldehyde dehydrogenase
Query= BRENDA::Q9K9B2 (515 letters) >NCBI__GCF_000092245.1:WP_013133826.1 Length = 483 Score = 251 bits (640), Expect = 5e-71 Identities = 159/483 (32%), Positives = 250/483 (51%), Gaps = 15/483 (3%) Query: 37 YPLIINGERVTTEDKIQSW-NPARKDQLVGSVSKANQDLAEKAIQSADEAFQTWRNVNPE 95 Y + INGE V+ + + NP+ K+ ++ + K N + A+ AI +A A W + Sbjct: 7 YEMYINGEFVSNKGETTPVINPSTKE-IISYIPKGNAEDAKVAIDAAHNAQDAWAKLPAV 65 Query: 96 ERANILVKAAAIIRRRKHEFSAWLVHEAGKPWKEADADTAEAIDFLEYYARQMIELNRGK 155 ER N L K A IR + + E GK A+ + D+L+Y A + G+ Sbjct: 66 ERGNYLRKIAQKIRENSDMLAKTITQEQGKVLGLAEVEVNFTADYLDYMA-EWARRYEGE 124 Query: 156 EILS-RPGEQNRYFYTPMGVTVTISPWNFALAIMVGTAVAPIVTGNTVVLKPASTTPVVA 214 I S RP E F P+GV + PWNF ++ ++TGNT+V+KP+ TP A Sbjct: 125 IIQSDRPNENIFLFKLPIGVATGVLPWNFPFFLIARKLAPALLTGNTIVIKPSGETPNNA 184 Query: 215 AKFVEVLEDAGLPKGVINYVPGSGAEVGDYLVDHPKTSLITFTGSKDVGVRLYERAAVVR 274 +F ++++ LPKGV N V GSG+ VG+ L + K +++FTGS GV++ E A+ Sbjct: 185 FEFAKLVDQIDLPKGVFNLVSGSGSTVGNELAANEKVGIVSFTGSVPTGVKIMEAAS--- 241 Query: 275 PGQNHLKRVIVEMGGKDTVVVDRDADLDLAAESILVSAFGFSGQKCSAGSRAVIHKDVYD 334 ++ +V +E+GGK +V DA+LD+A E+I S +GQ C+ R +HK + Sbjct: 242 ---KNVTKVSLELGGKAPAIVMADANLDIAVEAIKNSRVTNNGQVCNCAERVYVHKSIAK 298 Query: 335 EVLEKTVALAKNLTVGDPTNRDNYMGPVIDEKAFEKIMSYIEIGKKEG-RLMTGGEG-DS 392 E ++ LT G+P MGP+I+E A + ++ G + TGG+ D Sbjct: 299 EFTDRITKSMAALTCGNPLTEKIDMGPLINEDAITHVQKLVDSAVAAGASITTGGKRCDR 358 Query: 393 STGFFIQPTIIADLDPEAVIMQEEIFGPVVAFSKANDFDHALEIANNTEYGLTGAVITRN 452 G+F +PT++ D+ + I++EEIFGPV+ + D A+ +AN++E+GLT ++ T+N Sbjct: 359 DDGYFYEPTVVIDVKQDMDIIKEEIFGPVLPIVTFDTLDEAIALANDSEFGLTSSIYTQN 418 Query: 453 RAHIEQAKREFHVGNLYFNRNCTGAIVGYHPFGGFKMSGTDSKAGGPDYLALHMQAKTVS 512 +A +E G Y NR A+ G+H G+K SG A G L +Q K V Sbjct: 419 LDIAMRACKEIKCGETYINRENFEAMQGFH--AGWKKSGIGG-ADGKHGLEEFLQTKVVY 475 Query: 513 EMY 515 Y Sbjct: 476 LQY 478 Lambda K H 0.316 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 575 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 515 Length of database: 483 Length adjustment: 34 Effective length of query: 481 Effective length of database: 449 Effective search space: 215969 Effective search space used: 215969 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory