Align High-affinity branched-chain amino acid transport ATP-binding protein LivG aka B3455, component of Leucine; leucine/isoleucine/valine porter (characterized)
to candidate WP_013134865.1 ARNIT_RS05295 urea ABC transporter ATP-binding protein UrtD
Query= TCDB::P0A9S7 (255 letters) >NCBI__GCF_000092245.1:WP_013134865.1 Length = 262 Score = 141 bits (355), Expect = 2e-38 Identities = 81/251 (32%), Positives = 146/251 (58%), Gaps = 10/251 (3%) Query: 5 LLSVNGLMMRFGGLLAVNNVNLELYPQEIVSLIGPNGAGKTTVFNCLTGFYKPTGGTILL 64 +L V+G+ + F G A+NN++ + E+ +IG NGAGK+T+ + +TG +P G ++ Sbjct: 21 ILLVDGVSVSFDGFKALNNLSFSINYGELRCIIGANGAGKSTMMDVVTGKTRPDEGEVIF 80 Query: 65 RDQ-HLEGLPGQQIARMGVVRTFQHVRLFREMTVIENLLVAQHQQLKTGLFSGLLKTPSF 123 + +L L I+ +G+ R FQ +F+ +V ENL +A + KT F Sbjct: 81 GEAVNLLELDEPTISEIGIGRKFQKPTVFQNHSVFENLELAMKDDKR------FFKT-LF 133 Query: 124 RRAQSEALDRAATWLERIGLLEHANRQASNLAYGDQRRLEIARCMVTQPEILMLDEPAAG 183 + +SE DR ++ IGL E N A L++G ++ LEI ++ +P++L++DEP AG Sbjct: 134 SKLRSEQKDRIEETMKLIGLKELYNLDAGILSHGQKQWLEIGMLIMQEPKLLLVDEPVAG 193 Query: 184 LNPKETKELDELIAELRNHHNTTILLIEHDMKLVMGISDRIYVVNQGTPLANGTPEQIRN 243 + P+E ++ E++ L + ++++EHDM+ + I+ ++ V+++G+ LA G + I+N Sbjct: 194 MTPQEVEKTAEILTSLSKEN--AVVVVEHDMEFIRSIASKVTVLHEGSVLAEGNMDAIQN 251 Query: 244 NPDVIRAYLGE 254 N V + YLGE Sbjct: 252 NEKVRKVYLGE 262 Lambda K H 0.320 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 262 Length adjustment: 24 Effective length of query: 231 Effective length of database: 238 Effective search space: 54978 Effective search space used: 54978 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory