Align ABC transporter for D-Alanine, ATPase component (characterized)
to candidate WP_013258465.1 DEBA_RS18365 ABC transporter ATP-binding protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_5405 (254 letters) >NCBI__GCF_000143965.1:WP_013258465.1 Length = 233 Score = 144 bits (362), Expect = 2e-39 Identities = 91/230 (39%), Positives = 133/230 (57%), Gaps = 9/230 (3%) Query: 14 IIQMQGVNKWYG----QFHVLKDINLNVKQGERIVLCGPSGSGKSTTIRCLNRLEEHQQG 69 +I+++ + K Y Q VLK ++L V QGE + L G SGSGKST + + L+ G Sbjct: 3 LIELREITKTYNLGEVQVPVLKGVSLGVAQGELVALMGASGSGKSTLMNIMGCLDRPSAG 62 Query: 70 RIVVDGVELTN-DLKQIEAIR-REVGMVFQHFNLFPHLTILQNCTLAPMWVRKMP-KRKA 126 + ++DG ++ Q +R R++G VFQ+F+L P + L+N + + P R+A Sbjct: 63 QYLLDGRDVAGFSADQRARLRNRKIGFVFQNFSLLPRTSALENVAMPLAYAADQPGDRQA 122 Query: 127 EEIAMHYLERVRIPEQAHKYPGQLSGGQQQRVAIARALCMKPKIMLFDEPTSALDPEMVK 186 + A LERV + ++ H P QLSGGQQQRVAIARAL +P+++L DEPT LD + + Sbjct: 123 RKRAAEMLERVGLAQRMHHEPNQLSGGQQQRVAIARALINRPELLLADEPTGNLDSKTSQ 182 Query: 187 EVLDTMIGL-AEDGMTMLCVTHEMGFARTVANRVIFMDKGEIVEQAAPND 235 EVL L EDG+T++ VTH+ AR A R I + G IV A + Sbjct: 183 EVLQMFAKLNEEDGITIILVTHDAEVARH-AKRTIAISDGVIVADGAEGE 231 Lambda K H 0.322 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 233 Length adjustment: 23 Effective length of query: 231 Effective length of database: 210 Effective search space: 48510 Effective search space used: 48510 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory