Align Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)
to candidate WP_013257036.1 DEBA_RS01005 ABC transporter ATP-binding protein
Query= TCDB::Q9HU32 (257 letters) >NCBI__GCF_000143965.1:WP_013257036.1 Length = 254 Score = 152 bits (383), Expect = 9e-42 Identities = 87/255 (34%), Positives = 146/255 (57%), Gaps = 12/255 (4%) Query: 1 MAEATPALEIRNLHKRYGDLEVLKGISLTARDGDVISILGSSGSGKSTFLRCINLLENPH 60 MA A +E+R+L K +G VL G++LT G + I+G SG GKS L+ + L P Sbjct: 1 MAAAENIIELRDLVKNFGRQRVLDGLNLTIPRGRITVIIGRSGGGKSVLLKHMIGLIKPD 60 Query: 61 QGQILVSGEELRLKKSKNGDLVAADSQQINRLRSELGFVFQNFNLWPHMSILDNVIEAPR 120 GQ+LV G+++ G L D +Q+N++R G +FQ+ L+ MS+ DNV R Sbjct: 61 AGQVLVGGQDI-------GHL---DDRQLNQIRRRFGMLFQDAALFDSMSVFDNVAFPLR 110 Query: 121 RVLGKSKAEAIEIAEGLLAKVGIADKRHSYPAQLSGGQQQRAAIARTLAMQPKVILFDEP 180 S AE I L VG+ P+QLSGG ++R +AR +A++P+++L+DEP Sbjct: 111 EHTSHSAAEIARIVADKLRMVGLPGVEAKMPSQLSGGMRKRVGLARAIALEPEIVLYDEP 170 Query: 181 TSALDPEMVQEVLNVIRALAEE-GRTMLLVTHEMSFARQVSSEVVFLHQGLVEEQGTPQQ 239 T+ LDP M + + +I E G T ++++H+++ A +++ ++ L+QG + G+P+Q Sbjct: 171 TTGLDPLMTEAINRLIADTQERLGITSVVISHDIAGALKIAHQIAMLYQGRIIASGSPEQ 230 Query: 240 VFENPQSARCKQFMS 254 + ++ +QF+S Sbjct: 231 IGDSDDPV-VRQFIS 244 Lambda K H 0.317 0.133 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 254 Length adjustment: 24 Effective length of query: 233 Effective length of database: 230 Effective search space: 53590 Effective search space used: 53590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory