Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate WP_013257036.1 DEBA_RS01005 ABC transporter ATP-binding protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_3435 (254 letters) >NCBI__GCF_000143965.1:WP_013257036.1 Length = 254 Score = 135 bits (339), Expect = 1e-36 Identities = 85/253 (33%), Positives = 145/253 (57%), Gaps = 14/253 (5%) Query: 4 LEVQDLHKRYGSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILLN 63 +E++DL K +G VL G++L G + IIG SG GKS L+ + L +P AG++L+ Sbjct: 8 IELRDLVKNFGRQRVLDGLNLTIPRGRITVIIGRSGGGKSVLLKHMIGLIKPDAGQVLVG 67 Query: 64 NEELKLVANKDGALKAADPKQLQRMRSRLSMVFQHFNLWSHMTAMENIMEAPVHVLGMSK 123 +++ G L D +QL ++R R M+FQ L+ M+ +N+ S Sbjct: 68 GQDI-------GHL---DDRQLNQIRRRFGMLFQDAALFDSMSVFDNVAFPLREHTSHSA 117 Query: 124 TEAREKAEHYLNKVGVAHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSALDPE 183 E L VG+ + P +SGG ++RV +ARA+A+EPE++L+DEPT+ LDP Sbjct: 118 AEIARIVADKLRMVGLPGVEAKMPSQLSGGMRKRVGLARAIALEPEIVLYDEPTTGLDP- 176 Query: 184 LVGDVLKVMQALAQE--GRTMVVVTHEMGFAREVSNQLVFLHKGVVEESGNPREVLVNPQ 241 L+ + + + A QE G T VV++H++ A ++++Q+ L++G + SG+P E + + Sbjct: 177 LMTEAINRLIADTQERLGITSVVISHDIAGALKIAHQIAMLYQGRIIASGSP-EQIGDSD 235 Query: 242 SERLQQFLSGSLK 254 ++QF+SGS++ Sbjct: 236 DPVVRQFISGSVE 248 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 254 Length adjustment: 24 Effective length of query: 230 Effective length of database: 230 Effective search space: 52900 Effective search space used: 52900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory