Align ABC transporter for L-Fucose, ATPase component (characterized)
to candidate WP_013257036.1 DEBA_RS01005 ABC transporter ATP-binding protein
Query= reanno::Smeli:SM_b21106 (365 letters) >NCBI__GCF_000143965.1:WP_013257036.1 Length = 254 Score = 126 bits (316), Expect = 7e-34 Identities = 74/243 (30%), Positives = 126/243 (51%), Gaps = 9/243 (3%) Query: 4 VTLKKLVKRYGALEVVHGIDLEVKDREFIALVGPSGCGKSTTLRMIAGLEEVSGGAIEIG 63 + L+ LVK +G V+ G++L + ++G SG GKS L+ + GL + G + +G Sbjct: 8 IELRDLVKNFGRQRVLDGLNLTIPRGRITVIIGRSGGGKSVLLKHMIGLIKPDAGQVLVG 67 Query: 64 GRKVNDLPPRA-----RNISMVFQSYALYPHMTVAENMGFSLKI-AGRPAEEIKTRVAEA 117 G+ + L R R M+FQ AL+ M+V +N+ F L+ A EI VA+ Sbjct: 68 GQDIGHLDDRQLNQIRRRFGMLFQDAALFDSMSVFDNVAFPLREHTSHSAAEIARIVADK 127 Query: 118 AAILDLAHLLERRPSQLSGGQRQRVAMGRAIVRQPDVFLFDEPLSNLDAKLRTQVRTEIK 177 ++ L + + PSQLSGG R+RV + RAI +P++ L+DEP + LD + + I Sbjct: 128 LRMVGLPGVEAKMPSQLSGGMRKRVGLARAIALEPEIVLYDEPTTGLDPLMTEAINRLIA 187 Query: 178 KLHARMQATMIYVTHDQVEAMTLSDRIVIMRDGHIEQVGTPEDVFRRP---ATKFVAGFI 234 R+ T + ++HD A+ ++ +I ++ G I G+PE + +F++G + Sbjct: 188 DTQERLGITSVVISHDIAGALKIAHQIAMLYQGRIIASGSPEQIGDSDDPVVRQFISGSV 247 Query: 235 GSP 237 P Sbjct: 248 EGP 250 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 230 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 254 Length adjustment: 27 Effective length of query: 338 Effective length of database: 227 Effective search space: 76726 Effective search space used: 76726 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory