Align ABC transporter related (characterized, see rationale)
to candidate WP_013257036.1 DEBA_RS01005 ABC transporter ATP-binding protein
Query= uniprot:B2TBJ9 (263 letters) >NCBI__GCF_000143965.1:WP_013257036.1 Length = 254 Score = 138 bits (347), Expect = 1e-37 Identities = 82/254 (32%), Positives = 144/254 (56%), Gaps = 12/254 (4%) Query: 3 ATAPVALSVKNIHKSFGDHHVLKGISLDAHQGDVISILGASGSGKSTFLRCLNLLETPDD 62 A A + ++++ K+FG VL G++L +G + I+G SG GKS L+ + L PD Sbjct: 2 AAAENIIELRDLVKNFGRQRVLDGLNLTIPRGRITVIIGRSGGGKSVLLKHMIGLIKPDA 61 Query: 63 GSVSLAGEELKMKRRGDGKLQPSDRRQVDRVRSQLGMVFQNFNLWSHMTVLENLIEGPMR 122 G V + G+++ G L D RQ++++R + GM+FQ+ L+ M+V +N+ Sbjct: 62 GQVLVGGQDI-------GHL---DDRQLNQIRRRFGMLFQDAALFDSMSVFDNVAFPLRE 111 Query: 123 VQKRSRAESVEEAEALLAKVGLAEKRGHYPAHLSGGQQQRVAIARALAMHPKVMLFDEPT 182 S AE L VGL P+ LSGG ++RV +ARA+A+ P+++L+DEPT Sbjct: 112 HTSHSAAEIARIVADKLRMVGLPGVEAKMPSQLSGGMRKRVGLARAIALEPEIVLYDEPT 171 Query: 183 SALDPELVGEVLRVMRSLAEE-GRTMLVVTHEMGFARHVSNRVMFLHQGQVEADGTPDEV 241 + LDP + + R++ E G T +V++H++ A +++++ L+QG++ A G+P+++ Sbjct: 172 TGLDPLMTEAINRLIADTQERLGITSVVISHDIAGALKIAHQIAMLYQGRIIASGSPEQI 231 Query: 242 FVECKSDRFRQFVS 255 + RQF+S Sbjct: 232 -GDSDDPVVRQFIS 244 Lambda K H 0.318 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 254 Length adjustment: 24 Effective length of query: 239 Effective length of database: 230 Effective search space: 54970 Effective search space used: 54970 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory