Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate WP_013257036.1 DEBA_RS01005 ABC transporter ATP-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_09610 (276 letters) >NCBI__GCF_000143965.1:WP_013257036.1 Length = 254 Score = 151 bits (382), Expect = 1e-41 Identities = 93/223 (41%), Positives = 133/223 (59%), Gaps = 3/223 (1%) Query: 48 VNDLSLSIGTGEIFVIMGLSGSGKSTLVRHFNRLIDPTSGAILVDGEDILQLDMDALREF 107 ++ L+L+I G I VI+G SG GKS L++H LI P +G +LV G+DI LD L + Sbjct: 23 LDGLNLTIPRGRITVIIGRSGGGKSVLLKHMIGLIKPDAGQVLVGGQDIGHLDDRQLNQI 82 Query: 108 RRHKISMVFQSFGLLPHKSVLDNVAYGLKVR-GESKQVCAERALHWINTVGLKGYENKYP 166 RR + M+FQ L SV DNVA+ L+ S A + VGL G E K P Sbjct: 83 RR-RFGMLFQDAALFDSMSVFDNVAFPLREHTSHSAAEIARIVADKLRMVGLPGVEAKMP 141 Query: 167 HQLSGGMRQRVGLARALAADTDIILMDEAFSALDPLIRAEMQDQLLELQKTLHKTIVFIT 226 QLSGGMR+RVGLARA+A + +I+L DE + LDPL+ + + + Q+ L T V I+ Sbjct: 142 SQLSGGMRKRVGLARAIALEPEIVLYDEPTTGLDPLMTEAINRLIADTQERLGITSVVIS 201 Query: 227 HDLDEAVRIGNRIAILKDGKLIQVGTPREILHSPADEYVDRFV 269 HD+ A++I ++IA+L G++I G+P +I S D V +F+ Sbjct: 202 HDIAGALKIAHQIAMLYQGRIIASGSPEQIGDSD-DPVVRQFI 243 Lambda K H 0.321 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 172 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 254 Length adjustment: 25 Effective length of query: 251 Effective length of database: 229 Effective search space: 57479 Effective search space used: 57479 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory