Align Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized)
to candidate WP_013257036.1 DEBA_RS01005 ABC transporter ATP-binding protein
Query= SwissProt::Q9YGA6 (372 letters) >NCBI__GCF_000143965.1:WP_013257036.1 Length = 254 Score = 128 bits (321), Expect = 2e-34 Identities = 74/244 (30%), Positives = 133/244 (54%), Gaps = 5/244 (2%) Query: 4 VRLVDVWKVFGEVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIG 63 + L D+ K FG + ++L + G +++G SG GK+ L+ + GL +P GQ+ +G Sbjct: 8 IELRDLVKNFGRQRVLDGLNLTIPRGRITVIIGRSGGGKSVLLKHMIGLIKPDAGQVLVG 67 Query: 64 DKLVADPEKGIFVPPKDRDIAMVFQSYALYPHMTVYDNIAFPLKLRKV-PRQEIDQRVRE 122 + + + + R M+FQ AL+ M+V+DN+AFPL+ EI + V + Sbjct: 68 GQDIGHLDDRQLNQIRRR-FGMLFQDAALFDSMSVFDNVAFPLREHTSHSAAEIARIVAD 126 Query: 123 VAELLGLTELLNRKPRELSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAEL 182 ++GL + + P +LSGG R+RV L RAI +P++ L DEP + LD + + + Sbjct: 127 KLRMVGLPGVEAKMPSQLSGGMRKRVGLARAIALEPEIVLYDEPTTGLDPLMTEAINRLI 186 Query: 183 KKLQRQLGVTTIYVTHDQVEAMTMGDRIAVMNRGVLQQVGSPDEVYDKP---ANTFVAGF 239 Q +LG+T++ ++HD A+ + +IA++ +G + GSP+++ D F++G Sbjct: 187 ADTQERLGITSVVISHDIAGALKIAHQIAMLYQGRIIASGSPEQIGDSDDPVVRQFISGS 246 Query: 240 IGSP 243 + P Sbjct: 247 VEGP 250 Lambda K H 0.323 0.142 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 232 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 372 Length of database: 254 Length adjustment: 27 Effective length of query: 345 Effective length of database: 227 Effective search space: 78315 Effective search space used: 78315 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory