Align glycine betaine/l-proline transport atp-binding protein prov (characterized)
to candidate WP_013258465.1 DEBA_RS18365 ABC transporter ATP-binding protein
Query= CharProtDB::CH_001555 (400 letters) >NCBI__GCF_000143965.1:WP_013258465.1 Length = 233 Score = 139 bits (349), Expect = 1e-37 Identities = 79/210 (37%), Positives = 119/210 (56%), Gaps = 3/210 (1%) Query: 44 VKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREV 103 +K SL + +GE+ +MG SGSGKST++ ++ L P+ GQ L+DG D+A S + + Sbjct: 23 LKGVSLGVAQGELVALMGASGSGKSTLMNIMGCLDRPSAGQYLLDGRDVAGFSADQRARL 82 Query: 104 RRKKIAMVFQSFALMPHMTVLDNTAFGMELAGINAEER--REKALDALRQVGLENYAHSY 161 R +KI VFQ+F+L+P + L+N A + A +R R++A + L +VGL H Sbjct: 83 RNRKIGFVFQNFSLLPRTSALENVAMPLAYAADQPGDRQARKRAAEMLERVGLAQRMHHE 142 Query: 162 PDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFI 221 P++LSGG +QRV +ARAL P++LL DE LD E+ KL + TI+ + Sbjct: 143 PNQLSGGQQQRVAIARALINRPELLLADEPTGNLDSKTSQEVLQMFAKLNEEDGITIILV 202 Query: 222 SHDLDEAMRIGDRIAIMQNGEVVQVGTPDE 251 +HD + A IAI +G +V G E Sbjct: 203 THDAEVARHAKRTIAI-SDGVIVADGAEGE 231 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 233 Length adjustment: 27 Effective length of query: 373 Effective length of database: 206 Effective search space: 76838 Effective search space used: 76838 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory