Align ABC transporter for D-Sorbitol, ATPase component (characterized)
to candidate WP_013257036.1 DEBA_RS01005 ABC transporter ATP-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_2941 (350 letters) >NCBI__GCF_000143965.1:WP_013257036.1 Length = 254 Score = 129 bits (325), Expect = 6e-35 Identities = 81/242 (33%), Positives = 131/242 (54%), Gaps = 17/242 (7%) Query: 4 LQLRGIEKFFGEHRAIKGIDLTIQQGEFIVFVGPSGCGKSTLLRLIAGLEAIDGGSLMLD 63 ++LR + K FG R + G++LTI +G V +G SG GKS LL+ + GL D G +++ Sbjct: 8 IELRDLVKNFGRQRVLDGLNLTIPRGRITVIIGRSGGGKSVLLKHMIGLIKPDAGQVLVG 67 Query: 64 GRDITDQPSS-----KRDLAMVFQSYALYPHMSVYENMSFALK------LAKVDKQVIDE 112 G+DI +R M+FQ AL+ MSV++N++F L+ A++ + V D+ Sbjct: 68 GQDIGHLDDRQLNQIRRRFGMLFQDAALFDSMSVFDNVAFPLREHTSHSAAEIARIVADK 127 Query: 113 KVQNAARILNLTQYLQRTPKELSGGQRQRVAIGRAIVRAPKVFLFDEPLSNLDAALRGQT 172 R++ L + P +LSGG R+RV + RAI P++ L+DEP + LD + Sbjct: 128 -----LRMVGLPGVEAKMPSQLSGGMRKRVGLARAIALEPEIVLYDEPTTGLDPLMTEAI 182 Query: 173 RVEIAKLHRDLGATTIYVTHDQVEAMTLADRVVVLRDGIIEQVGTPLELYDKPANQFVAQ 232 IA LG T++ ++HD A+ +A ++ +L G I G+P ++ D + V Q Sbjct: 183 NRLIADTQERLGITSVVISHDIAGALKIAHQIAMLYQGRIIASGSPEQIGDSD-DPVVRQ 241 Query: 233 FI 234 FI Sbjct: 242 FI 243 Lambda K H 0.320 0.137 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 227 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 350 Length of database: 254 Length adjustment: 26 Effective length of query: 324 Effective length of database: 228 Effective search space: 73872 Effective search space used: 73872 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory