Align Sugar ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_013258465.1 DEBA_RS18365 ABC transporter ATP-binding protein
Query= uniprot:A0A165KQ08 (355 letters) >NCBI__GCF_000143965.1:WP_013258465.1 Length = 233 Score = 144 bits (362), Expect = 3e-39 Identities = 83/221 (37%), Positives = 124/221 (56%), Gaps = 8/221 (3%) Query: 5 LDIAGINKRFGKGDKSVEVLRKVDIHVAPGEFLILVGPSGCGKSTLLNIIAGLDEPTEGE 64 +++ I K + G+ V VL+ V + VA GE + L+G SG GKSTL+NI+ LD P+ G+ Sbjct: 4 IELREITKTYNLGEVQVPVLKGVSLGVAQGELVALMGASGSGKSTLMNIMGCLDRPSAGQ 63 Query: 65 IRIGGKNVVGMPP------RDRDIAMVFQSYALYPTLSVADNIGFALEMRKMPKPERQ-- 116 + G++V G R+R I VFQ+++L P S +N+ L +RQ Sbjct: 64 YLLDGRDVAGFSADQRARLRNRKIGFVFQNFSLLPRTSALENVAMPLAYAADQPGDRQAR 123 Query: 117 KRIDEVAAMLQISHLLDRRPSQLSGGQRQRVAMGRALARQPQLFLFDEPLSNLDAKLRVE 176 KR E+ + ++ + P+QLSGGQ+QRVA+ RAL +P+L L DEP NLD+K E Sbjct: 124 KRAAEMLERVGLAQRMHHEPNQLSGGQQQRVAIARALINRPELLLADEPTGNLDSKTSQE 183 Query: 177 MRAEIKRLHQASGITSVYVTHDQVEAMTLGSRIAVMKGGVV 217 + +L++ GIT + VTHD A IA+ G +V Sbjct: 184 VLQMFAKLNEEDGITIILVTHDAEVARHAKRTIAISDGVIV 224 Lambda K H 0.318 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 355 Length of database: 233 Length adjustment: 26 Effective length of query: 329 Effective length of database: 207 Effective search space: 68103 Effective search space used: 68103 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory