GapMind for catabolism of small carbon sources

 

Protein WP_013419062.1 in Rhodomicrobium vannielii ATCC 17100

Annotation: NCBI__GCF_000166055.1:WP_013419062.1

Length: 344 amino acids

Source: GCF_000166055.1 in NCBI

Candidate for 65 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
sucrose catabolism thuK med ABC transporter (characterized, see rationale) 42% 83% 231.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-maltose catabolism malK med Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 41% 86% 226.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
xylitol catabolism Dshi_0546 med ABC transporter for Xylitol, ATPase component (characterized) 41% 80% 218.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-maltose catabolism musK med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 40% 88% 217.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 41% 83% 214.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 41% 83% 214.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-maltose catabolism malK_Bb med ABC-type maltose transport, ATP binding protein (characterized, see rationale) 41% 77% 214.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
lactose catabolism lacK med ABC transporter for Lactose, ATPase component (characterized) 43% 78% 213.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
putrescine catabolism potA med PotG aka B0855, component of Putrescine porter (characterized) 41% 78% 208.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-maltose catabolism malK_Aa med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 43% 71% 204.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
trehalose catabolism treV med TreV, component of Trehalose porter (characterized) 41% 73% 172.2 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 39% 95% 216.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-mannitol catabolism mtlK lo SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 38% 96% 215.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-cellobiose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 40% 94% 215.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-glucose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 40% 94% 215.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
lactose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 40% 94% 215.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-maltose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 40% 94% 215.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
sucrose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 40% 94% 215.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
trehalose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 40% 94% 215.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-maltose catabolism thuK lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 38% 92% 212.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 38% 92% 212.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
trehalose catabolism thuK lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 38% 92% 212.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 40% 81% 211.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 37% 92% 210.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 37% 96% 210.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 88% 209.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 88% 209.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 88% 209.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-maltose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 88% 209.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 88% 209.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
sucrose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 88% 209.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 88% 209.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
trehalose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 88% 209.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 88% 209.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 40% 74% 204.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 37% 91% 203.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 37% 91% 203.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 36% 96% 203.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 38% 84% 199.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 35% 94% 195.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
trehalose catabolism malK lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 35% 94% 195.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 36% 87% 192.2 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 36% 94% 186.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 80% 177.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 80% 177.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 80% 177.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 80% 177.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 80% 177.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 80% 177.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 80% 177.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 80% 177.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 34% 77% 170.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 34% 77% 170.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 34% 77% 170.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 34% 77% 170.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
L-proline catabolism opuBA lo BilEA aka OpuBA protein, component of A proline/glycine betaine uptake system. Also reported to be a bile exclusion system that exports oxgall and other bile compounds, BilEA/EB or OpuBA/BB (required for normal virulence) (characterized) 39% 76% 164.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
glycerol catabolism glpT lo ABC transporter for Glycerol, ATPase component 2 (characterized) 31% 88% 147.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
glycerol catabolism glpS lo GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized) 31% 87% 147.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-fructose catabolism frcA lo ABC-type sugar transport system, ATP-binding protein; EC 3.6.3.17 (characterized, see rationale) 34% 58% 123.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
sucrose catabolism frcA lo ABC-type sugar transport system, ATP-binding protein; EC 3.6.3.17 (characterized, see rationale) 34% 58% 123.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
L-arabinose catabolism xylGsa lo Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale) 35% 87% 119.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
L-arabinose catabolism araVsh lo ABC transporter related (characterized, see rationale) 32% 61% 117.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
myo-inositol catabolism PGA1_c07320 lo Inositol transport system ATP-binding protein (characterized) 31% 93% 110.2 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
myo-inositol catabolism iatA lo Inositol transport ATP-binding protein IatA, component of The myoinositol (high affinity)/ D-ribose (low affinity) transporter IatP/IatA/IbpA. The structure of IbpA with myoinositol bound has been solved (characterized) 33% 61% 109.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4
D-galactose catabolism ytfR lo galactofuranose ABC transporter putative ATP binding subunit (EC 7.5.2.9) (characterized) 31% 60% 109 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 46% 238.4

Sequence Analysis Tools

View WP_013419062.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MTDLTKTAAPFLRINGVSKRFGDVAALRDVSLDLREGEIHALIGPSGCGKSTLLRIAAGF
EAADEGAVHLGQRRIDTLKPEARGIGIVFQDYALFPHLTVAQNVAFALKYADDARRADGT
APLLRMVRLDGLESRYPDELSGGQQQRCALARTFAAGPRAILLDEPFSNLDASLRETTRR
EIRDILKASGLGILFVTHDREEALSFADRISVLRDGRVEQTGLPKDLYFRPANAFVAGFL
GSTNFLDGIADGRSAETPLGRVTLDRPASGPVLLSLRPEAIGIAPEGGGVPAIVASLVFK
GHDASAFVRVGETTFEVLMPASLDVQPGQCVSVAARASAVVLKE

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory