GapMind for catabolism of small carbon sources

 

Protein WP_013459998.1 in Sulfuricurvum kujiense DSM 16994

Annotation: NCBI__GCF_000183725.1:WP_013459998.1

Length: 291 amino acids

Source: GCF_000183725.1 in NCBI

Candidate for 89 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-mannitol catabolism mtlK med ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component (characterized) 41% 76% 184.9 PalK, component of Palatinose (isomaltulose; 6-O-α-D-glucopyranosyl-D-fructose) uptake porter 42% 184.1
D-sorbitol (glucitol) catabolism mtlK med ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component (characterized) 41% 76% 184.9 PalK, component of Palatinose (isomaltulose; 6-O-α-D-glucopyranosyl-D-fructose) uptake porter 42% 184.1
L-asparagine catabolism glnQ med Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 40% 81% 137.5 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-glutamate catabolism gltL med Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 40% 81% 137.5 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 43% 64% 180.6 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-maltose catabolism malK lo Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 43% 60% 178.7 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-maltose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 44% 58% 176.8 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
trehalose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 44% 58% 176.8 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
putrescine catabolism potA lo spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) 46% 57% 174.9 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 41% 61% 171 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-cellobiose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 45% 53% 170.6 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-glucose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 45% 53% 170.6 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
lactose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 45% 53% 170.6 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-maltose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 45% 53% 170.6 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
sucrose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 45% 53% 170.6 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
trehalose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 45% 53% 170.6 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 42% 54% 170.2 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 46% 52% 169.5 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 39% 64% 169.1 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 43% 51% 169.1 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 41% 61% 168.7 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 43% 59% 168.7 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 44% 62% 168.3 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
sucrose catabolism thuK lo ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 42% 61% 168.3 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 39% 60% 166.4 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
trehalose catabolism malK lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 39% 60% 166.4 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 34% 84% 166 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 34% 84% 166 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 34% 84% 166 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 34% 84% 166 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 34% 84% 166 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 34% 84% 166 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 34% 84% 166 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 34% 84% 166 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-maltose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 40% 61% 165.2 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 41% 60% 165.2 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
sucrose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 40% 61% 165.2 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
trehalose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 40% 61% 165.2 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 39% 70% 165.2 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 45% 52% 165.2 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 41% 61% 162.9 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 41% 61% 162.9 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 58% 160.6 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 58% 160.6 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 58% 160.6 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 58% 160.6 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 42% 54% 160.6 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 58% 160.6 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 58% 160.6 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
trehalose catabolism treV lo TreV, component of Trehalose porter (characterized) 42% 65% 159.8 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 37% 65% 159.1 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 37% 65% 159.1 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 37% 65% 159.1 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 37% 65% 159.1 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 39% 61% 156.4 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 40% 53% 154.5 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 39% 63% 150.2 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-proline catabolism opuBA lo BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) 36% 55% 146.7 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-arginine catabolism artP lo Arginine transport ATP-binding protein ArtP; EC 7.4.2.- (characterized) 37% 94% 141.7 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-asparagine catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 37% 84% 137.5 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-aspartate catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 37% 84% 137.5 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
glycerol catabolism glpT lo GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized) 37% 57% 136.7 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-asparagine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 36% 86% 134.8 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-asparagine catabolism aatP lo Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 38% 90% 134.8 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-aspartate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 36% 86% 134.8 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-aspartate catabolism aatP lo Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 38% 90% 134.8 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-glutamate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 36% 86% 134.8 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-histidine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 36% 86% 134.8 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-leucine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 36% 86% 134.8 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-proline catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 36% 86% 134.8 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 36% 87% 132.9 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
glycerol catabolism glpS lo GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized) 35% 58% 128.6 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-tryptophan catabolism ecfA2 lo Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale) 35% 75% 119.4 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
D-cellobiose catabolism cbtF lo CbtF, component of Cellobiose and cellooligosaccharide porter (characterized) 35% 56% 109 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-proline catabolism HSERO_RS00895 lo ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale) 32% 94% 109 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-alanine catabolism braF lo High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 84% 106.3 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-isoleucine catabolism livG lo High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 84% 106.3 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-leucine catabolism livG lo High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 84% 106.3 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-serine catabolism braF lo High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 84% 106.3 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-threonine catabolism braF lo High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 84% 106.3 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-valine catabolism livG lo High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 84% 106.3 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-arabinose catabolism xylGsa lo Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale) 31% 94% 104.8 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-alanine catabolism braG lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 30% 75% 90.5 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-isoleucine catabolism natE lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 30% 75% 90.5 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-leucine catabolism natE lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 30% 75% 90.5 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-proline catabolism natE lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 30% 75% 90.5 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-serine catabolism braG lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 30% 75% 90.5 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-threonine catabolism braG lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 30% 75% 90.5 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9
L-valine catabolism natE lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 30% 75% 90.5 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 41% 184.9

Sequence Analysis Tools

View WP_013459998.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MISVNITKRLDTSEGSLNACFELTITDGEFLTLFGPSGAGKTTLMRMIAGLEQPESGIIE
VDGEVWFDSTKKINLTPQKRSVGFVFQDYALFPTMSVRENLLFAAETAEQRRSVDELIEL
VELSQLSERLPATLSGGQKQRVALARALVRHPKILLLDEPLSALDPTMRQKLQDELSLLH
KRLGITTLLVSHDISETVKLSDRMASIELGKIIRVGDPLEFFSPHTLSTKLQLIGEVLKI
EEDFPISVVTLLVGSSVVRTVLSNEEAHLLCVGKHAIISTKAFNPIVMPVE

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory