Align Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale)
to candidate WP_013459814.1 SULKU_RS04825 LPS export ABC transporter ATP-binding protein
Query= uniprot:G8ALJ1 (236 letters) >NCBI__GCF_000183725.1:WP_013459814.1 Length = 240 Score = 129 bits (324), Expect = 5e-35 Identities = 76/223 (34%), Positives = 126/223 (56%), Gaps = 10/223 (4%) Query: 15 EALKGVDIEIGAGEIVSLIGANGAGKSTLLMTICGSPRARMGRITFEGQDITQMPTYELV 74 E ++G+ +++ GE+V L+G NGAGK+T +CG A G++ +G+D++ +P ++ Sbjct: 17 EIVRGISMDLRTGEVVGLLGPNGAGKTTTFYMVCGLVEATGGKVYIDGEDVSGLPLHQRS 76 Query: 75 RLGIAQSPEGRRIFPRMSVLENLQMGSITAKPGSFANE-----LERVLTLFPRLKERISQ 129 R+GI P+ IF ++V ENL I A+ G E +E +L +F ++ ++ Sbjct: 77 RMGIGYLPQEASIFKDLTVEENL---IIAAQAGKLDQEMAEKRIEELLEMF-NIEPIRNR 132 Query: 130 RAGTMSGGEQQMLAIGRALMSQPRLLLLDEPSLGLAPLVVKQIFQAVKDINREQKMTVFM 189 R +SGGE++ I RAL+++PR LLLDEP G+ P+ V I Q V E + V + Sbjct: 133 RGINLSGGERRRAEIARALVNKPRFLLLDEPFAGVDPIAVMDI-QGVISQLVEYGIGVLI 191 Query: 190 VEQNAFHALKLAHRGYVMVNGKVTMSGTGAELLANEEVRSAYL 232 + N L + R YV+ +G++ SG+ E+ N +VR YL Sbjct: 192 TDHNVRETLAVCDRAYVIKSGELLASGSSDEIANNPDVRQHYL 234 Lambda K H 0.320 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 240 Length adjustment: 23 Effective length of query: 213 Effective length of database: 217 Effective search space: 46221 Effective search space used: 46221 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory