Align D-lactate transporter, ATP-binding component (characterized)
to candidate WP_013459814.1 SULKU_RS04825 LPS export ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF1248 (251 letters) >NCBI__GCF_000183725.1:WP_013459814.1 Length = 240 Score = 119 bits (297), Expect = 7e-32 Identities = 78/248 (31%), Positives = 125/248 (50%), Gaps = 15/248 (6%) Query: 4 LEVKNVGKRFGGLQALSDVNLSVRENTVHAIIGPNGAGKSTLLNCLVGKLIPDTGSVMFD 63 L ++N+ K + + +++ +R V ++GPNGAGK+T + G + G V D Sbjct: 4 LRIENLVKTIKNHEIVRGISMDLRTGEVVGLLGPNGAGKTTTFYMVCGLVEATGGKVYID 63 Query: 64 GKSVLGRAPYEINQMGISRVFQTPEIFGDLSVLENMMIPCFAKRDGAFEMNAISAVSGQR 123 G+ V G ++ ++MGI + Q IF DL+V EN++I A A + Sbjct: 64 GEDVSGLPLHQRSRMGIGYLPQEASIFKDLTVEENLII-------------AAQAGKLDQ 110 Query: 124 DILEK-AEHMLEEMNMADKRHMNAASMSRGDKRRLEIGMCLSQEPRLLLLDEPTAGMARA 182 ++ EK E +LE N+ R+ ++S G++RR EI L +PR LLLDEP AG+ Sbjct: 111 EMAEKRIEELLEMFNIEPIRNRRGINLSGGERRRAEIARALVNKPRFLLLDEPFAGVDPI 170 Query: 183 DTNNTIDLLKQIKSERDITIAIIEHDMHVVFSLADRITVLAQGTPLVEDDPQNIKGNPKV 242 + ++ Q+ E I + I +H++ ++ DR V+ G L I NP V Sbjct: 171 AVMDIQGVISQL-VEYGIGVLITDHNVRETLAVCDRAYVIKSGELLASGSSDEIANNPDV 229 Query: 243 REAYLGES 250 R+ YLGES Sbjct: 230 RQHYLGES 237 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 143 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 240 Length adjustment: 24 Effective length of query: 227 Effective length of database: 216 Effective search space: 49032 Effective search space used: 49032 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory