Align Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_013459998.1 SULKU_RS05735 ATP-binding cassette domain-containing protein
Query= uniprot:P0DTT6 (251 letters) >NCBI__GCF_000183725.1:WP_013459998.1 Length = 291 Score = 99.4 bits (246), Expect = 7e-26 Identities = 67/205 (32%), Positives = 120/205 (58%), Gaps = 23/205 (11%) Query: 25 MEINKGEVVALLGDNGAGKSTLIKIISGYHKPDRGDLVFEGKKVIFNSPN------DARS 78 + I GE + L G +GAGK+TL+++I+G +P+ G + +G+ V F+S RS Sbjct: 23 LTITDGEFLTLFGPSGAGKTTLMRMIAGLEQPESGIIEVDGE-VWFDSTKKINLTPQKRS 81 Query: 79 LGIETIYQDLALIPDLPIYYNIFLAREVTNKIFLNKKKMMEESKKLLDSLQI--RIPDIN 136 +G ++QD AL P + + N+ A E + ++ ++E +L++ Q+ R+P Sbjct: 82 VGF--VFQDYALFPTMSVRENLLFAAETAEQ-----RRSVDELIELVELSQLSERLP--- 131 Query: 137 MKVENLSGGQRQAVAVARAVYFSAKMILMDEPTAALSVVEARKVL-ELARNLKKKGLGVL 195 LSGGQ+Q VA+ARA+ K++L+DEP +AL +K+ EL+ K+ G+ L Sbjct: 132 ---ATLSGGQKQRVALARALVRHPKILLLDEPLSALDPTMRQKLQDELSLLHKRLGITTL 188 Query: 196 IITHNIIQGYEVADRIYVLDRGKII 220 +++H+I + +++DR+ ++ GKII Sbjct: 189 LVSHDISETVKLSDRMASIELGKII 213 Lambda K H 0.318 0.137 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 123 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 291 Length adjustment: 25 Effective length of query: 226 Effective length of database: 266 Effective search space: 60116 Effective search space used: 60116 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory