Align Arginine transport ATP-binding protein ArtP; EC 7.4.2.- (characterized)
to candidate WP_013459998.1 SULKU_RS05735 ATP-binding cassette domain-containing protein
Query= SwissProt::P0AAF6 (242 letters) >NCBI__GCF_000183725.1:WP_013459998.1 Length = 291 Score = 137 bits (345), Expect = 2e-37 Identities = 85/227 (37%), Positives = 132/227 (58%), Gaps = 13/227 (5%) Query: 13 GAHQALFDITLDCPQGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLNIAGN-HFDFTKT 71 G+ A F++T+ GE L L GPSGAGK++L+R++ LE P SG + + G FD TK Sbjct: 15 GSLNACFELTIT--DGEFLTLFGPSGAGKTTLMRMIAGLEQPESGIIEVDGEVWFDSTKK 72 Query: 72 PSDKAIRDLRRNVGMVFQQYNLWPHLTVQQNLIEAPCRVLGLSKDQALARAEKLLERLRL 131 + + +R+VG VFQ Y L+P ++V++NL+ A + ++L+E + L Sbjct: 73 IN---LTPQKRSVGFVFQDYALFPTMSVRENLLFAA------ETAEQRRSVDELIELVEL 123 Query: 132 KPYSDRYPLHLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPEITAQIVSIIREL-AET 190 S+R P LSGGQ+QRVA+ARAL+ P++LL DEP +ALDP + ++ + L Sbjct: 124 SQLSERLPATLSGGQKQRVALARALVRHPKILLLDEPLSALDPTMRQKLQDELSLLHKRL 183 Query: 191 NITQVIVTHEVEVARKTASRVVYMENGHIVEQGDASCFTEPQTEAFK 237 IT ++V+H++ K + R+ +E G I+ GD F P T + K Sbjct: 184 GITTLLVSHDISETVKLSDRMASIELGKIIRVGDPLEFFSPHTLSTK 230 Lambda K H 0.320 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 291 Length adjustment: 25 Effective length of query: 217 Effective length of database: 266 Effective search space: 57722 Effective search space used: 57722 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory