Align The pmf-dependent citrate uptake system, Cit1 (characterized)
to candidate WP_013459243.1 SULKU_RS01940 DASS family sodium-coupled anion symporter
Query= TCDB::Q6D017 (484 letters) >NCBI__GCF_000183725.1:WP_013459243.1 Length = 467 Score = 297 bits (761), Expect = 5e-85 Identities = 165/470 (35%), Positives = 258/470 (54%), Gaps = 16/470 (3%) Query: 14 MIVILVIAAFFWQMEPPAGLNPAAWHSAVIFVATIVCIVANVLPIGAIGIISITLFALTY 73 ++++ + A W PP ++P AW IF+ TI+ I+ NVLPI A +I++ + L Sbjct: 11 VVLLGMFALTLWLTPPPLAISPKAWQLFTIFLTTIIAILGNVLPIIAASVIALAISVLF- 69 Query: 74 AAGDKTASGAIQT--ALSDLNSSLIWLIVVAFMIARGFIKTGLGRRIALQMIRLLGKRTL 131 G I+ A + + S I +I+ AF+++ K+GLG+R++L +IR G TL Sbjct: 70 --------GVIEPVKAYAGFSESFILMIIAAFLVSHAVHKSGLGKRLSLHIIRRFGHSTL 121 Query: 132 GLAYGLAFADLVLSPAMPSNTARCGGIIYPIADSLSRSFDSKPEDASRSKIGTFLITCIG 191 GL Y L D++++PA PSNTAR G++YPI L+ SK D ++ + G++L+ Sbjct: 122 GLGYSLIATDILIAPAFPSNTAR-SGVLYPIVYGLAHDCGSKVGDNTQRRAGSYLMMTSM 180 Query: 192 NVNDVTAAMFMTAYTGNLLAVKLAANAGVTITWGSWFLAALVPCLISLAIVPLLVYWLTK 251 +++ +++TA N + V +A G+ IT+GSW L A+VP LI+ A++P ++Y + Sbjct: 181 AGLTISSGLWLTAMAVNPVGVGIAETMGIHITFGSWLLYAIVPTLIAFALIPWMLYRIYP 240 Query: 252 PEIRHTPDAPKLAVAELAKMGSISRGEWLMAFTVILLLVLWIFGDRLGVDATTASFVGLS 311 PE+R TPDAP+ A L MG ISR EW+ A I +L W LG+D +F GL Sbjct: 241 PELRSTPDAPQKAKEALEHMGRISRNEWITAGVFISMLTFWALSGVLGIDKAAVAFGGLG 300 Query: 312 FLLLTGVLSWEDVKNEKGAWDTLIWFAALLMMANQLKKLGFTNWFGDLIGSNIGHLMQGT 371 L+ T V ED +++ A TLIWFA L ++ QL ++GF + S+ + G Sbjct: 301 ILMATRVFGVEDFRSQGEALSTLIWFAILFALSTQLAEMGFMG----AVASHFTLYLVGL 356 Query: 372 SWVLVLLLLNAAYFYTHYFFASGNAQIAALFAVFLGVGINLNIPAVPMAFMLAFTSSLYC 431 SW+ V +LL A Y HY F S +A + ALF +FL VG+ +P MA ML F ++ Sbjct: 357 SWMWVYILLIAVYVLIHYLFVSQSAHLLALFGIFLAVGVGAGVPGELMAMMLLFATNFNA 416 Query: 432 SLTQYTHARGPILFGAGYVPTAVWWRTGFVVSLVNQAIFMGAGLLWWKAI 481 ++T + I +GY+ + G V+L+ +FM G W A+ Sbjct: 417 TITPQGSSCNAIYLSSGYISAREIYIYGGAVTLLTFLVFMIIGTPWILAL 466 Lambda K H 0.327 0.139 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 739 Number of extensions: 35 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 484 Length of database: 467 Length adjustment: 33 Effective length of query: 451 Effective length of database: 434 Effective search space: 195734 Effective search space used: 195734 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory