Align ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized)
to candidate WP_013459998.1 SULKU_RS05735 ATP-binding cassette domain-containing protein
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1897 (386 letters) >NCBI__GCF_000183725.1:WP_013459998.1 Length = 291 Score = 167 bits (424), Expect = 3e-46 Identities = 94/207 (45%), Positives = 128/207 (61%), Gaps = 11/207 (5%) Query: 25 ELKIDDGEFLILVGPSGCGKSTLMNCIAGLETISGGAILVD------DADISGMSPKDRD 78 EL I DGEFL L GPSG GK+TLM IAGLE G I VD ++P+ R Sbjct: 22 ELTITDGEFLTLFGPSGAGKTTLMRMIAGLEQPESGIIEVDGEVWFDSTKKINLTPQKRS 81 Query: 79 IAMVFQSYALYPTMSVRDNIAFGLKIRKMPTAEIDEEVARVSKLLQIEHLLSRKPGQLSG 138 + VFQ YAL+PTMSVR+N+ F + TAE V + +L+++ L R P LSG Sbjct: 82 VGFVFQDYALFPTMSVRENLLFAAE-----TAEQRRSVDELIELVELSQLSERLPATLSG 136 Query: 139 GQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKLMHQRLKTTTVYVTHDQIE 198 GQ+QRVA+ RAL R PKI L DEPLS LD +R +++ E+ L+H+RL TT+ V+HD E Sbjct: 137 GQKQRVALARALVRHPKILLLDEPLSALDPTMRQKLQDELSLLHKRLGITTLLVSHDISE 196 Query: 199 AMTLGDKVAVMKDGIIQQFGTPKDIYN 225 + L D++A ++ G I + G P + ++ Sbjct: 197 TVKLSDRMASIELGKIIRVGDPLEFFS 223 Lambda K H 0.319 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 291 Length adjustment: 28 Effective length of query: 358 Effective length of database: 263 Effective search space: 94154 Effective search space used: 94154 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory