Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_013459814.1 SULKU_RS04825 LPS export ABC transporter ATP-binding protein
Query= TCDB::Q55164 (267 letters) >NCBI__GCF_000183725.1:WP_013459814.1 Length = 240 Score = 122 bits (305), Expect = 9e-33 Identities = 80/254 (31%), Positives = 127/254 (50%), Gaps = 25/254 (9%) Query: 19 LLAQGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIRPDQGEVLFN 78 L + L K+ V + ++ G + GL+GPNGAGKTT F ++ + G+V + Sbjct: 4 LRIENLVKTIKNHEIVRGISMDLRTGEVVGLLGPNGAGKTTTFYMVCGLVEATGGKVYID 63 Query: 79 GDSIGQLAPHQIALRGSVRTFQVAKVLSRLTVLENMLLADQ-----HQTGEKFLPRLINF 133 G+ + L HQ + G Q A + LTV EN+++A Q + EK + L+ Sbjct: 64 GEDVSGLPLHQRSRMGIGYLPQEASIFKDLTVEENLIIAAQAGKLDQEMAEKRIEELLEM 123 Query: 134 RRVQKEERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKLILLDEP 193 + E NR G+ LSGG+R+ E+ARAL++ P+ +LLDEP Sbjct: 124 FNI--EPIRNRR---------GIN---------LSGGERRRAEIARALVNKPRFLLLDEP 163 Query: 194 AAGVNPTLIGQICEHIVNWNRQGITFLVIEHNMDVIMTLCHHVWVLAEGRNLADGTPEQI 253 AGV+P + I I GI L+ +HN+ + +C +V+ G LA G+ ++I Sbjct: 164 FAGVDPIAVMDIQGVISQLVEYGIGVLITDHNVRETLAVCDRAYVIKSGELLASGSSDEI 223 Query: 254 QSDPRVLEAYLGDS 267 ++P V + YLG+S Sbjct: 224 ANNPDVRQHYLGES 237 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 240 Length adjustment: 24 Effective length of query: 243 Effective length of database: 216 Effective search space: 52488 Effective search space used: 52488 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory