Align acyl CoA carboxylase biotin carboxylase subunit (EC 2.1.3.15; EC 6.4.1.3; EC 6.3.4.14) (characterized)
to candidate WP_013461228.1 SULKU_RS11930 acetyl-CoA carboxylase biotin carboxylase subunit
Query= metacyc::MONOMER-13597 (509 letters) >NCBI__GCF_000183725.1:WP_013461228.1 Length = 446 Score = 375 bits (964), Expect = e-108 Identities = 208/446 (46%), Positives = 283/446 (63%), Gaps = 5/446 (1%) Query: 1 MPPFSRVLVANRGEIATRVLKAIKEMGMTAIAVYSEADKYAVHTKYADEAYYIGKAPALD 60 M R+LVANRGEIA R ++ IKEMG A+AVYS ADK A + K AD A IG AP+ Sbjct: 1 MAELKRILVANRGEIALRAIRTIKEMGKEAVAVYSTADKDASYLKLADAAICIGAAPSSQ 60 Query: 61 SYLNIEHIIDAAEKAHVDAIHPGYGFLSENAEFAEAVEKAGITFIGPSSEVMRKIKDKLD 120 SYLNI II A E + DA+ PGYGFLSEN F E GI FIGP+ EVM + DK Sbjct: 61 SYLNIPAIIAACEISGCDAVFPGYGFLSENQHFVEICTHHGIKFIGPTPEVMVMMSDKSK 120 Query: 121 GKRLANMAGVPTAPGSDGPVTSIDEALKLAEKIGYPIMVKAASGGGGVGITRVDNQDQLM 180 K + AGVP PGSDG + I EA A+++GYP+++KAA+GGGG G+ V+++ + Sbjct: 121 AKDVMIAAGVPVVPGSDGAIKDIAEAKVRAKEVGYPVILKAAAGGGGRGMRVVEDESYIE 180 Query: 181 DVWERNKRLAYQAFGKADLFIEKYAVNPRHIEFQLIGDKYGNYVVAWERECTIQRRNQKL 240 + + + A AFG +++EK+ NPRHIE Q+I D +GN + ER+C++QRR+QKL Sbjct: 181 NAFLAAEAEAIGAFGDGTIYMEKFIKNPRHIEVQVIADSHGNVLHIGERDCSMQRRHQKL 240 Query: 241 IEEAPSPALKMEERESMFEPIIKFGKLINYFTLGTFETAFSDVSRDFYFLELNKRLQVEH 300 IEE+P+ AL E R + ++ K I Y GTFE D + FYF+E+N RLQVEH Sbjct: 241 IEESPAVALTPEIRAELHASAVRATKYIKYEGAGTFEYLL-DADKKFYFMEMNTRLQVEH 299 Query: 301 PTTELIFRIDLVKLQIKLAAGEHLPFSQEDLNKRVRGTAIEYRINAEDALNNFTGSSGFV 360 +E++ +DL+++ I++A GE LP SQE + ++G +IE RI AED + F S G + Sbjct: 300 CVSEMVSGLDLIEMMIRVAEGEALP-SQESV--VLKGHSIECRITAEDPI-KFLPSPGKI 355 Query: 361 TYYREPTGPGVRVDSGIESGSYVPPYYDSLVSKLIVYGESREYAIQAGIRALADYKIGGI 420 T + P G VR+D+ +G VPP YDS++ KLIVYG R AI RAL+++ I GI Sbjct: 356 TQWIAPGGRNVRIDTHAHAGYIVPPTYDSMIGKLIVYGTDRNDAIARMHRALSEFTITGI 415 Query: 421 KTTIELYKWIMQDPDFQEGKFSTSYI 446 KTTI + +M++PDF F T Y+ Sbjct: 416 KTTIPFHMKMMKNPDFINNNFDTKYL 441 Lambda K H 0.317 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 539 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 509 Length of database: 446 Length adjustment: 33 Effective length of query: 476 Effective length of database: 413 Effective search space: 196588 Effective search space used: 196588 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory