Align Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized)
to candidate WP_013459998.1 SULKU_RS05735 ATP-binding cassette domain-containing protein
Query= SwissProt::P19566 (369 letters) >NCBI__GCF_000183725.1:WP_013459998.1 Length = 291 Score = 177 bits (448), Expect = 4e-49 Identities = 92/205 (44%), Positives = 136/205 (66%), Gaps = 11/205 (5%) Query: 24 LDIHDGEFVVFVGPSGCGKSTLLRMIAGLETITSG------DLFIGETRMNDIPPAERGV 77 L I DGEF+ GPSG GK+TL+RMIAGLE SG +++ T+ ++ P +R V Sbjct: 23 LTITDGEFLTLFGPSGAGKTTLMRMIAGLEQPESGIIEVDGEVWFDSTKKINLTPQKRSV 82 Query: 78 GMVFQSYALYPHLSVAENMSFGLKLAGAKKEVMNQRVNQVAEVLQLAHLLERKPKALSGG 137 G VFQ YAL+P +SV EN+ F + A ++ V +++ E+++L+ L ER P LSGG Sbjct: 83 GFVFQDYALFPTMSVRENLLFAAETAEQRRSV-----DELIELVELSQLSERLPATLSGG 137 Query: 138 QRQRVAIGRTLVAEPRVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEA 197 Q+QRVA+ R LV P++ LLDEPLS LD +R +++ E+S LHKRLG T + V+HD E Sbjct: 138 QKQRVALARALVRHPKILLLDEPLSALDPTMRQKLQDELSLLHKRLGITTLLVSHDISET 197 Query: 198 MTLADKIVVLDAGRVAQVGKPLELY 222 + L+D++ ++ G++ +VG PLE + Sbjct: 198 VKLSDRMASIELGKIIRVGDPLEFF 222 Lambda K H 0.321 0.138 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 227 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 369 Length of database: 291 Length adjustment: 28 Effective length of query: 341 Effective length of database: 263 Effective search space: 89683 Effective search space used: 89683 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory