Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate WP_013459998.1 SULKU_RS05735 ATP-binding cassette domain-containing protein
Query= BRENDA::Q70HW1 (384 letters) >NCBI__GCF_000183725.1:WP_013459998.1 Length = 291 Score = 152 bits (385), Expect = 9e-42 Identities = 83/208 (39%), Positives = 125/208 (60%), Gaps = 11/208 (5%) Query: 24 FNLDIQDKEFTVFVGPSGCGKTTTLRMIAGLEDI------TEGNLYIGDRRVNDVPPKDR 77 F L I D EF GPSG GKTT +RMIAGLE +G ++ + ++ P+ R Sbjct: 21 FELTITDGEFLTLFGPSGAGKTTLMRMIAGLEQPESGIIEVDGEVWFDSTKKINLTPQKR 80 Query: 78 DIAMVFQNYALYPHMTVYQNMAFGLKLRKVPKAEIDRRVQEAAKILDIAHLLDRKPKALS 137 + VFQ+YAL+P M+V +N+ F + AE R V E ++++++ L +R P LS Sbjct: 81 SVGFVFQDYALFPTMSVRENLLFAAET-----AEQRRSVDELIELVELSQLSERLPATLS 135 Query: 138 GGQRQRVALGRAIVREPQVFLMDEPLSNLDAKLRVQMRAEIRKLHQRLQTTVIYVTHDQT 197 GGQ+QRVAL RA+VR P++ L+DEPLS LD +R +++ E+ LH+RL T + V+HD + Sbjct: 136 GGQKQRVALARALVRHPKILLLDEPLSALDPTMRQKLQDELSLLHKRLGITTLLVSHDIS 195 Query: 198 EAMTMGDRIVVMRDGVIQQADTPQVVYS 225 E + + DR+ + G I + P +S Sbjct: 196 ETVKLSDRMASIELGKIIRVGDPLEFFS 223 Lambda K H 0.321 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 291 Length adjustment: 28 Effective length of query: 356 Effective length of database: 263 Effective search space: 93628 Effective search space used: 93628 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory