Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate WP_013459998.1 SULKU_RS05735 ATP-binding cassette domain-containing protein
Query= BRENDA::Q8NMV1 (376 letters) >NCBI__GCF_000183725.1:WP_013459998.1 Length = 291 Score = 168 bits (426), Expect = 2e-46 Identities = 88/207 (42%), Positives = 133/207 (64%), Gaps = 11/207 (5%) Query: 24 FNLEIADGEFLVLVGPSGCGKSTTLRMLAGLENV------TDGAIFIGDKDVTHVAPRDR 77 F L I DGEFL L GPSG GK+T +RM+AGLE DG ++ ++ P+ R Sbjct: 21 FELTITDGEFLTLFGPSGAGKTTLMRMIAGLEQPESGIIEVDGEVWFDSTKKINLTPQKR 80 Query: 78 DIAMVFQNYALYPHMTVGENMGFALKIAGKSQDEINKRVDEAAATLGLTEFLERKPKALS 137 + VFQ+YAL+P M+V EN+ FA + A E + VDE + L++ ER P LS Sbjct: 81 SVGFVFQDYALFPTMSVRENLLFAAETA-----EQRRSVDELIELVELSQLSERLPATLS 135 Query: 138 GGQRQRVAMGRAIVRNPQVFLMDEPLSNLDAKLRVQTRTQIAALQRKLGVTTVYVTHDQT 197 GGQ+QRVA+ RA+VR+P++ L+DEPLS LD +R + + +++ L ++LG+TT+ V+HD + Sbjct: 136 GGQKQRVALARALVRHPKILLLDEPLSALDPTMRQKLQDELSLLHKRLGITTLLVSHDIS 195 Query: 198 EALTMGDRIAVLKDGYLQQVGAPRELY 224 E + + DR+A ++ G + +VG P E + Sbjct: 196 ETVKLSDRMASIELGKIIRVGDPLEFF 222 Lambda K H 0.316 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 291 Length adjustment: 28 Effective length of query: 348 Effective length of database: 263 Effective search space: 91524 Effective search space used: 91524 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory