Align High-affinity branched-chain amino acid transport ATP-binding protein (characterized, see rationale)
to candidate WP_013459814.1 SULKU_RS04825 LPS export ABC transporter ATP-binding protein
Query= uniprot:A0A159ZWL6 (233 letters) >NCBI__GCF_000183725.1:WP_013459814.1 Length = 240 Score = 146 bits (369), Expect = 3e-40 Identities = 78/233 (33%), Positives = 136/233 (58%), Gaps = 3/233 (1%) Query: 2 LQFENVSTFYGKIQALHSVNVEVRQGEIVTLIGANGAGKSTLLMTLCGSPQAHSGSIRYM 61 L+ EN+ + + +++++R GE+V L+G NGAGK+T +CG +A G + Sbjct: 4 LRIENLVKTIKNHEIVRGISMDLRTGEVVGLLGPNGAGKTTTFYMVCGLVEATGGKVYID 63 Query: 62 GEELVGQDSSHIMRKSIAVVPEGRRVFARLTVEENLAMGGFF--TDKGDYQEQMDKVLHL 119 GE++ G R I +P+ +F LTVEENL + D+ +++++++L + Sbjct: 64 GEDVSGLPLHQRSRMGIGYLPQEASIFKDLTVEENLIIAAQAGKLDQEMAEKRIEELLEM 123 Query: 120 FPRLKERFTQRGGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFDIIEQL 179 F ++ +RG +SGGE++ I RAL++KP+ LLLDEP G+ PI + I +I QL Sbjct: 124 F-NIEPIRNRRGINLSGGERRRAEIARALVNKPRFLLLDEPFAGVDPIAVMDIQGVISQL 182 Query: 180 RKDGVTVFLVEQNANQALKIADRAYVLENGRVVMQGTGEALLTDPKVREAYLG 232 + G+ V + + N + L + DRAYV+++G ++ G+ + + +P VR+ YLG Sbjct: 183 VEYGIGVLITDHNVRETLAVCDRAYVIKSGELLASGSSDEIANNPDVRQHYLG 235 Lambda K H 0.320 0.137 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 136 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 240 Length adjustment: 23 Effective length of query: 210 Effective length of database: 217 Effective search space: 45570 Effective search space used: 45570 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory