Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate WP_013459998.1 SULKU_RS05735 ATP-binding cassette domain-containing protein
Query= uniprot:D8J1T6 (255 letters) >NCBI__GCF_000183725.1:WP_013459998.1 Length = 291 Score = 104 bits (260), Expect = 2e-27 Identities = 69/218 (31%), Positives = 110/218 (50%), Gaps = 24/218 (11%) Query: 26 ITIERGQIYGLIGPNGAGKTTFFNVITGLYQPDTGTFELDGKPYSPSAPH---EVAKAGI 82 +TI G+ L GP+GAGKTT +I GL QP++G E+DG+ + S K + Sbjct: 23 LTITDGEFLTLFGPSGAGKTTLMRMIAGLEQPESGIIEVDGEVWFDSTKKINLTPQKRSV 82 Query: 83 ARTFQNIRLFGEMTVLENVMVGCHVRTKQNVFGAVFRHKAAREEEAAIREKSQKLLDFVG 142 FQ+ LF M+V EN++ E A R +L++ V Sbjct: 83 GFVFQDYALFPTMSVRENLLFAA--------------------ETAEQRRSVDELIELVE 122 Query: 143 IGQFAKRTARHLSYGDQRRLEIARALATDPQLLALDEPAAGMNATEKLGLR-ELLVKIQA 201 + Q ++R LS G ++R+ +ARAL P++L LDEP + ++ T + L+ EL + + Sbjct: 123 LSQLSERLPATLSGGQKQRVALARALVRHPKILLLDEPLSALDPTMRQKLQDELSLLHKR 182 Query: 202 EGKTILLIEHDVKLMMGLCNRITVLDYGKPIAEGVPAD 239 G T LL+ HD+ + L +R+ ++ GK I G P + Sbjct: 183 LGITTLLVSHDISETVKLSDRMASIELGKIIRVGDPLE 220 Lambda K H 0.320 0.138 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 291 Length adjustment: 25 Effective length of query: 230 Effective length of database: 266 Effective search space: 61180 Effective search space used: 61180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory