Align NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_013459998.1 SULKU_RS05735 ATP-binding cassette domain-containing protein
Query= TCDB::Q8YT15 (247 letters) >NCBI__GCF_000183725.1:WP_013459998.1 Length = 291 Score = 86.7 bits (213), Expect = 5e-22 Identities = 58/192 (30%), Positives = 105/192 (54%), Gaps = 11/192 (5%) Query: 35 VESGELVTVIGPNGAGKSTLAKTIFGLLTPHTGKITFKGKNIAGLKSNQIVRL-----GM 89 + GE +T+ GP+GAGK+TL + I GL P +G I G+ S + + L + Sbjct: 25 ITDGEFLTLFGPSGAGKTTLMRMIAGLEQPESGIIEVDGE--VWFDSTKKINLTPQKRSV 82 Query: 90 CYVPQIANVFPSLSVEENLEMGAFIRNDSLQPLKDKIFAMFPRLSDRRRQRAGTLSGGER 149 +V Q +FP++SV ENL A + D++ + LS + TLSGG++ Sbjct: 83 GFVFQDYALFPTMSVRENLLFAA--ETAEQRRSVDELIELV-ELSQLSERLPATLSGGQK 139 Query: 150 QMLAMGKALMLEPSLLVLDEPSAALSPILVTQVFEQVKQINQE-GTAIILVEQNARKALE 208 Q +A+ +AL+ P +L+LDEP +AL P + ++ +++ +++ G +LV + + ++ Sbjct: 140 QRVALARALVRHPKILLLDEPLSALDPTMRQKLQDELSLLHKRLGITTLLVSHDISETVK 199 Query: 209 MADRGYVLESGR 220 ++DR +E G+ Sbjct: 200 LSDRMASIELGK 211 Lambda K H 0.317 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 291 Length adjustment: 25 Effective length of query: 222 Effective length of database: 266 Effective search space: 59052 Effective search space used: 59052 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory