Align AraV, component of Arabinose, fructose, xylose porter (characterized)
to candidate WP_013459998.1 SULKU_RS05735 ATP-binding cassette domain-containing protein
Query= TCDB::Q97UF2 (371 letters) >NCBI__GCF_000183725.1:WP_013459998.1 Length = 291 Score = 157 bits (397), Expect = 3e-43 Identities = 87/224 (38%), Positives = 134/224 (59%), Gaps = 6/224 (2%) Query: 28 ITIDSGMAFGVLGPSGHGKTTFLRLIAGLEEPTSGYIYFDNEA-VSSPRRVMMSPEKRGI 86 +TI G + GPSG GKTT +R+IAGLE+P SG I D E S +++ ++P+KR + Sbjct: 23 LTITDGEFLTLFGPSGAGKTTLMRMIAGLEQPESGIIEVDGEVWFDSTKKINLTPQKRSV 82 Query: 87 AMVFQNWALYPNMTVFDNIAFPLKLAKVPKDKIENKVKEVSEELGLSGVLNRYPKELSGG 146 VFQ++AL+P M+V +N+ F + A+ + V E+ E + LS + R P LSGG Sbjct: 83 GFVFQDYALFPTMSVRENLLFAAETAEQRRS-----VDELIELVELSQLSERLPATLSGG 137 Query: 147 QMQRTAIARALVKDPKVLLLDEPFSNLDAQIRESARALVRKIQRERKLTTLIVSHDPADI 206 Q QR A+ARALV+ PK+LLLDEP S LD +R+ + + + + +TTL+VSHD ++ Sbjct: 138 QKQRVALARALVRHPKILLLDEPLSALDPTMRQKLQDELSLLHKRLGITTLLVSHDISET 197 Query: 207 FAIANKAGVIVNGKFAQIGTPTEIYEYPATDLIARLTGEINLIQ 250 ++++ I GK ++G P E + +L GE+ I+ Sbjct: 198 VKLSDRMASIELGKIIRVGDPLEFFSPHTLSTKLQLIGEVLKIE 241 Lambda K H 0.317 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 199 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 291 Length adjustment: 28 Effective length of query: 343 Effective length of database: 263 Effective search space: 90209 Effective search space used: 90209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory