Align D-lactate dehydrogenase (cytochrome) (EC 1.1.2.4) (characterized)
to candidate WP_013461037.1 SULKU_RS10970 FAD-linked oxidase C-terminal domain-containing protein
Query= BRENDA::Q94AX4 (567 letters) >NCBI__GCF_000183725.1:WP_013461037.1 Length = 461 Score = 249 bits (636), Expect = 2e-70 Identities = 141/421 (33%), Positives = 223/421 (52%), Gaps = 8/421 (1%) Query: 146 PDVVVFPRSEEEVSKILKSCNEYKVPIVPYGGATSIEGHTLAPKGGVCIDMSL-MKRVKA 204 P+ V+FPR E++VS ILK CNE+K+ IVP G + G L GG+ + M ++ Sbjct: 40 PEAVLFPRHEQDVSDILKYCNEHKIVIVPRGAGSGFTGGALPANGGIVLAFEKHMNKILE 99 Query: 205 LHVEDMDVIVEPGIGWLELNEYLEEYGLFFPLDPGPG--ASIGGMCATRCSGSLAVRYGT 262 + +++M +V+PG+ +EL +EE GLF+P DP ++IGG G A +YG Sbjct: 100 IDMQNMVAVVQPGVVNMELQRAVEEVGLFYPPDPASQEYSTIGGNVNENAGGMRAAKYGI 159 Query: 263 MRDNVISLKVVLPNGDVVKTASRARKSAAGYDLTRLIIGSEGTLGVITEITLRLQKIPQH 322 +D V++++ VLPNGD++K + K AGY++ ++I SEGTL V TE+TL+L P+ Sbjct: 160 TKDYVMAIRAVLPNGDIIKAGKKTIKDVAGYNIAGILIASEGTLAVTTEVTLKLLSKPKM 219 Query: 323 SVVAVCNFPTVKDAADVAIATMMSGIQVSRVELLDEVQIRAINMANGKNL-TEAPTLMFE 381 + A+ FPTV A + TM SG+ +E LD + IRA+ K L EA ++ Sbjct: 220 TKTAMGIFPTVHSAMEAVYKTMASGVTPVAMEFLDNLTIRAVEQTYHKGLPVEAGAILVT 279 Query: 382 FI--GTEAYTREQTQIVQQIASKHNGSDFMFAEEPEAKKELWKIRKEALWACYAMAPGHE 439 + E Q ++ ++ ++ SDF A+ + +LW R+ A + G + Sbjct: 280 DVDGNLEEDLDFQLDVIGRVFRENGCSDFHIAQNKQEASDLWFARRNASQSLSVY--GSK 337 Query: 440 AMITDVCVPLSHLAELISRSKKELDASSLLCTVIAHAGDGNFHTCIMFDPSSEEQRREAE 499 + DV VP S L L+ + K D ++ H GDGN HT +M D EQ + Sbjct: 338 KLNEDVTVPRSALPALLDQFYKIADKYNIKIPCFGHTGDGNVHTNVMVDGKDPEQVKIGY 397 Query: 500 RLNHFMVHSALSMDGTCTGEHGVGTGKMKYLEKELGIEALQTMKRIKKTLDPNDIMNPGK 559 + + + + + GT +GEHG+G K Y+ E + + IK+ DPN+I+NP K Sbjct: 398 KAIEEVFQATIDLGGTLSGEHGIGLAKAPYMGMAFTPEEMALFQSIKRAFDPNNILNPSK 457 Query: 560 L 560 + Sbjct: 458 M 458 Lambda K H 0.318 0.133 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 555 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 567 Length of database: 461 Length adjustment: 35 Effective length of query: 532 Effective length of database: 426 Effective search space: 226632 Effective search space used: 226632 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory