Align Lactate utilization protein A (characterized)
to candidate WP_013460851.1 SULKU_RS10040 (Fe-S)-binding protein
Query= SwissProt::O07020 (238 letters) >NCBI__GCF_000183725.1:WP_013460851.1 Length = 425 Score = 126 bits (316), Expect = 8e-34 Identities = 73/246 (29%), Positives = 122/246 (49%), Gaps = 17/246 (6%) Query: 2 KVSLFVTCLVDMFQTNVGKATVELLERLGCEVDFPEGQICCGQPAYNSG----YVHDAKK 57 +V++F+ CL + T +GK +E+LE L + P+ Q+CCG PAY +G H+AKK Sbjct: 179 RVAIFIGCLANYNYTEIGKGLLEILEALNIDAFIPKKQLCCGAPAYFTGDFATVDHNAKK 238 Query: 58 AMKRMIETFQDSEYVVSPSGSCTTMFR-EYPHLFQDDPKWADKAKKLADKTYELTDFIVN 116 + + E ++ P +C+ M + +Y H F D P+W ++AKKL K + T+++ Sbjct: 239 NIVYFESFIDEVEAIIIPEATCSAMIKIDYEHFFHDQPEWLERAKKLKSKIFMATEWLEQ 298 Query: 117 VLGVEDVGATLHTK------ATLHTSCHMTRLLGVRKEPMKLLSHVKGLQFTELPGKHNC 170 ++GA L +K T H CH ++ GV KEP L+ + TE+ + C Sbjct: 299 ---KTELGALLASKGRSDLSVTYHDPCHARKMQGVYKEPRALVG--QNYTITEMSDPNAC 353 Query: 171 CGFGG-TFSVKMAQISEQMVDEKVECVEETGAEVLIGADCGCLMNIGGRLGRKDKNVKVM 229 CGFGG T + ++ K + +TGA+V+ C M I + +V Sbjct: 354 CGFGGVTMQTENFHFAQAAGKPKAAMIAKTGAQVVTAECSACRMQINNSMNEAKLDVVFK 413 Query: 230 HIAEVL 235 + E++ Sbjct: 414 NPIELI 419 Lambda K H 0.321 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 238 Length of database: 425 Length adjustment: 27 Effective length of query: 211 Effective length of database: 398 Effective search space: 83978 Effective search space used: 83978 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory