Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate WP_013459998.1 SULKU_RS05735 ATP-binding cassette domain-containing protein
Query= BRENDA::Q97UY8 (353 letters) >NCBI__GCF_000183725.1:WP_013459998.1 Length = 291 Score = 163 bits (412), Expect = 6e-45 Identities = 88/224 (39%), Positives = 136/224 (60%), Gaps = 6/224 (2%) Query: 26 INIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRL-VASNGKLIVPPEDRKI 84 + I +GE + GPSGAGKTT MR+IAGL+ P +G + D + S K+ + P+ R + Sbjct: 23 LTITDGEFLTLFGPSGAGKTTLMRMIAGLEQPESGIIEVDGEVWFDSTKKINLTPQKRSV 82 Query: 85 GMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGG 144 G VFQ +AL+P ++ EN+ F E R+ V+E+ +++++ + P LSGG Sbjct: 83 GFVFQDYALFPTMSVRENLLFAAETA-----EQRRSVDELIELVELSQLSERLPATLSGG 137 Query: 145 QQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADI 204 Q+QRVALARALV+ P +LLLDEP S LD MR + + + RLG+T L+VSHD ++ Sbjct: 138 QKQRVALARALVRHPKILLLDEPLSALDPTMRQKLQDELSLLHKRLGITTLLVSHDISET 197 Query: 205 FAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELE 248 ++DR+ + GK+++VG P + + LIGE+ ++E Sbjct: 198 VKLSDRMASIELGKIIRVGDPLEFFSPHTLSTKLQLIGEVLKIE 241 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 233 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 291 Length adjustment: 28 Effective length of query: 325 Effective length of database: 263 Effective search space: 85475 Effective search space used: 85475 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory