Align ABC transporter for Xylitol, ATPase component (characterized)
to candidate WP_013459998.1 SULKU_RS05735 ATP-binding cassette domain-containing protein
Query= reanno::Dino:3607124 (338 letters) >NCBI__GCF_000183725.1:WP_013459998.1 Length = 291 Score = 161 bits (407), Expect = 2e-44 Identities = 92/229 (40%), Positives = 138/229 (60%), Gaps = 14/229 (6%) Query: 1 MAGIKIDK-INKFYGTTQALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSGR 59 M + I K ++ G+ A F+ L I DGEF+ GPSG GK+TL+R +AGLE SG Sbjct: 1 MISVNITKRLDTSEGSLNACFE--LTITDGEFLTLFGPSGAGKTTLMRMIAGLEQPESGI 58 Query: 60 IEIGGR---DVT---TVEPADRDLAMVFQSYALYPHMTVRENMEFGMKVNGFEPDLRKER 113 IE+ G D T + P R + VFQ YAL+P M+VREN+ F E ++ Sbjct: 59 IEVDGEVWFDSTKKINLTPQKRSVGFVFQDYALFPTMSVRENLLFAA-----ETAEQRRS 113 Query: 114 IAEAARVLQLEDYLDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMR 173 + E +++L +R P LSGGQ+QRVA+ RA+V++P + L DEPLS LD +R +++ Sbjct: 114 VDELIELVELSQLSERLPATLSGGQKQRVALARALVRHPKILLLDEPLSALDPTMRQKLQ 173 Query: 174 VELEGLHKQLGATMIYVTHDQVEAMTMADKIVVLNRGRIEQVGSPMDLY 222 EL LHK+LG T + V+HD E + ++D++ + G+I +VG P++ + Sbjct: 174 DELSLLHKRLGITTLLVSHDISETVKLSDRMASIELGKIIRVGDPLEFF 222 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 198 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 291 Length adjustment: 27 Effective length of query: 311 Effective length of database: 264 Effective search space: 82104 Effective search space used: 82104 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory