Align PP1069, component of Acidic amino acid uptake porter, AatJMQP (characterized)
to candidate WP_013530398.1 MESCI_RS12985 amino acid ABC transporter permease
Query= TCDB::Q88NY4 (223 letters) >NCBI__GCF_000185905.1:WP_013530398.1 Length = 359 Score = 118 bits (295), Expect = 2e-31 Identities = 74/212 (34%), Positives = 112/212 (52%), Gaps = 9/212 (4%) Query: 16 WEGMVMTLKLMVMGVIGGIVLGTILALMRLSSSKLLSNLAGAYVNYFRSIPLLLVITWFY 75 W G+ +TL + V + G L LAL+R S +S G ++ RS+PL+ ++ F Sbjct: 150 WGGLALTLFIFVTTCLIGFPLAICLALLRRSELPWISRTTGLIIDGVRSLPLISILFTFA 209 Query: 76 LAVPFVL-RWITGEDTPVGAFTSCVVAFMMFEAAYFCEIVRAGVQSISKGQMGAAQALGM 134 + +PF L +W+ G+ ++ +F +AY EIVR G+Q ++ GQ AA ALGM Sbjct: 210 VVLPFALPQWLQGDK-----LYRVILGSALFFSAYQAEIVRGGMQGVATGQEEAAMALGM 264 Query: 135 NYAQTMRLIILPQAFRKMTPLLLQQSIILFQDTSLVYTVGLVDFL---NSARSNGDIIGR 191 Y Q + I+LPQA R P + Q +I F++TSLV VG + L N+A G+ Sbjct: 265 RYWQRISRILLPQAMRNAMPATINQFVISFKETSLVVIVGFFEILASGNAAYGTGEWRFA 324 Query: 192 SHEFLIFAGVVYFLISFSASWLVKRLQKRISV 223 E F +YF+ FS S L++R+SV Sbjct: 325 YVEVYAFIAFIYFIFVFSLSRYGAFLERRMSV 356 Lambda K H 0.330 0.141 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 223 Length of database: 359 Length adjustment: 26 Effective length of query: 197 Effective length of database: 333 Effective search space: 65601 Effective search space used: 65601 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory