Align Glutamate/aspartate import permease protein GltK (characterized)
to candidate WP_013533449.1 MESCI_RS28750 amino acid ABC transporter permease
Query= SwissProt::P0AER5 (224 letters) >NCBI__GCF_000185905.1:WP_013533449.1 Length = 253 Score = 129 bits (323), Expect = 7e-35 Identities = 79/224 (35%), Positives = 125/224 (55%), Gaps = 13/224 (5%) Query: 4 FDWSSIVPSLPYLLDGLVITLKITVTAVVIGILWGTMLAVMRL--SSFAPVAWFAKAYVN 61 F W+ I PS + GL +++++++ + IG+ LAV R+ SSFA + A + Sbjct: 36 FRWAPIWPSAGLIAQGLWLSIQLSILSTAIGLAAAIPLAVARVHGSSFARIP--AVFLIE 93 Query: 62 VFRSIPLVMVLLWFYLIVPGFL-QNVLGLSPKNDIRLISAMVAFSMFEAAYYSEIIRAGI 120 + R+ P +MV+ W Y P Q + G + +A+VA S+ A+Y +E+IRAG+ Sbjct: 94 IVRATPELMVIFWVYFGAPAITGQPIDGWT--------AALVAMSIIAASYLAEVIRAGL 145 Query: 121 QSISRGQSSAALALGMTHWQSMKLIILPQAFRAMVPLLLTQGIVLFQDTSLVYVLSLADF 180 S+ +GQ AA + G+ +WQS K IILPQA M+P LL+Q I+LF+ TSLV ++ + DF Sbjct: 146 YSVDKGQWEAAASTGLNNWQSFKWIILPQAISNMMPALLSQVIMLFKTTSLVSMVGVIDF 205 Query: 181 FRTASTIGERDGTQVEMILFAGFVYFVISLSASLLVSYLKRRTA 224 FR A + + G YF+I + SL+V + R + Sbjct: 206 FRAAQITNSNTFSPYAIYTLVGIGYFIICGTLSLVVKRWRGRVS 249 Lambda K H 0.330 0.140 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 224 Length of database: 253 Length adjustment: 23 Effective length of query: 201 Effective length of database: 230 Effective search space: 46230 Effective search space used: 46230 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory