Align ABC transporter for D-glucosamine, permease component 1 (characterized)
to candidate WP_013530556.1 MESCI_RS13785 amino acid ABC transporter permease
Query= reanno::pseudo3_N2E3:AO353_21715 (220 letters) >NCBI__GCF_000185905.1:WP_013530556.1 Length = 224 Score = 126 bits (316), Expect = 4e-34 Identities = 73/214 (34%), Positives = 112/214 (52%), Gaps = 7/214 (3%) Query: 10 VWRDFDTL-------LAGLGLGLELALVSIAIGCVIGLLMAFALLSKHRALRVLASVYVT 62 +W+ +L L GLG+ + L+L+S+ +G ++G + +R + L +V Sbjct: 2 IWQQLQSLAGSYPLALRGLGMTVLLSLISLVLGTLLGFALGILRTGGNRLISGLIGAWVD 61 Query: 63 VIRNTPILVLILLIYFALPSLGIRLDKLPSFIITLSLYAGAYLTEVFRGGLLSIPKGLRE 122 +IR TP LV I LI+F LP GI LD + II L+ A ++ E+ G+ S+P G E Sbjct: 62 LIRGTPFLVQIFLIFFILPEFGIELDAFTAGIIALTNLAACFICEIVVAGIRSVPTGQVE 121 Query: 123 AGLAIGLGEWQVKAYVTVPVMLRNVLPALSNNFISLFKDTSLAAAIAVPELTYYARKINV 182 A LA GL WQ V +P +R VLP L ++ L KD+S+ +AI + +LT + Sbjct: 122 AALASGLSRWQRMRQVVLPQAMRIVLPPLVGQYVLLIKDSSVVSAIGLTDLTRVGWLVVQ 181 Query: 183 ESYRVIETWLVTTALYVAACYLIAMLLRYLEQRL 216 + + + A Y CY + ML R LEQR+ Sbjct: 182 RVPNGLLVFFLVGAGYFIVCYPLIMLARRLEQRM 215 Lambda K H 0.329 0.143 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 128 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 220 Length of database: 224 Length adjustment: 22 Effective length of query: 198 Effective length of database: 202 Effective search space: 39996 Effective search space used: 39996 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory