Align ABC transporter for D-glucosamine, permease component 2 (characterized)
to candidate WP_013530556.1 MESCI_RS13785 amino acid ABC transporter permease
Query= reanno::pseudo3_N2E3:AO353_21720 (220 letters) >NCBI__GCF_000185905.1:WP_013530556.1 Length = 224 Score = 126 bits (317), Expect = 3e-34 Identities = 67/197 (34%), Positives = 115/197 (58%) Query: 21 GFLTSVQCSVLAIMLGTLIGIVAGLVLTYGTLWMRAPFRFYVDLIRGTPVFVLVLACFYM 80 G +V S+++++LGTL+G G++ T G + +VDLIRGTP V + F++ Sbjct: 19 GLGMTVLLSLISLVLGTLLGFALGILRTGGNRLISGLIGAWVDLIRGTPFLVQIFLIFFI 78 Query: 81 APALGWQIDAFQAGVLGLTLFCGSHVAEIVRGALQALPRGQMEASKAIGLTFYQALAYVL 140 P G ++DAF AG++ LT + EIV ++++P GQ+EA+ A GL+ +Q + V+ Sbjct: 79 LPEFGIELDAFTAGIIALTNLAACFICEIVVAGIRSVPTGQVEAALASGLSRWQRMRQVV 138 Query: 141 LPQALRQILPTWVNSSTEIVKASTLLSVIGVAELLLSTQQIIARTFMTLEFYLFAGFLFF 200 LPQA+R +LP V ++K S+++S IG+ +L ++ R L + G +F Sbjct: 139 LPQAMRIVLPPLVGQYVLLIKDSSVVSAIGLTDLTRVGWLVVQRVPNGLLVFFLVGAGYF 198 Query: 201 IINYAIELLGRHIEKRV 217 I+ Y + +L R +E+R+ Sbjct: 199 IVCYPLIMLARRLEQRM 215 Lambda K H 0.330 0.142 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 177 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 220 Length of database: 224 Length adjustment: 22 Effective length of query: 198 Effective length of database: 202 Effective search space: 39996 Effective search space used: 39996 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory